KEGG   Drosophila persimilis: Dper_GL16156Help
Entry
Dper_GL16156      CDS       T01063                                 

Definition
GL16156 gene product from transcript GL16156-RA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 140 aa AA seqDB search
MKAFIVLVALALAAPAFGRTMDRCSLAREMSDLGVPRDQLARWTCIAEHESSYRTGVVGP
ENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNNLLTDDITNSVRCAQKVLSQQGW
SAWSTWKYCDGSLPSINDCF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcatcgttctggttgccctggctctggccgctcccgctttcggtcgcacc
atggaccgttgctccctggcccgcgagatgtccgacctgggcgtcccccgcgatcagctg
gcccgctggacctgcattgccgagcacgagagctcctaccgcaccggagtggtcggaccc
gagaactacaacggctccaacgactacggcatcttccagatcaacgactactactggtgc
gctccccccagcggtcgcttctcctacaacgagtgcggcctgagctgcaacaacctgttg
accgacgacatcaccaactccgtgcgttgcgcccagaaggtcctctcccagcagggatgg
tccgcctggtccacctggaagtactgcgacggctccctgccctccatcaacgactgcttc
taa

DBGET integrated database retrieval system