KEGG   Drosophila persimilis: Dper_GL16158Help
Entry
Dper_GL16158      CDS       T01063                                 

Definition
GL16158 gene product from transcript GL16158-RA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dper_GL16158
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dper_GL16158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 170 aa AA seqDB search
MKAFIVLVALALAAPAFGRTMDRCSLAREMSDLGVPRDQLARWTCIAEHESSYRTGVVGP
ENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNNLLTDDITNSVRCAQKVLSQQGW
SAWSTWEVLRRLPALHQRLLLSSDFDPWINDCIKRICISLNPLLFRPANA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcatcgttctggttgccctggctctggccgctcccgctttcggtcgcacc
atggaccgttgctccctggcccgcgagatgtccgacctgggcgttccccgcgatcagctg
gcccgctggacctgcattgccgagcacgagtcctcctaccgcaccggagtggtcggaccc
gagaactacaacggctccaacgactacggcatcttccagatcaacgactactactggtgc
gctccccccagcggtcgcttctcctacaacgagtgcggcctgagctgcaacaacctgttg
accgacgacatcaccaactccgtgcgttgcgcccagaaggtcctctcccagcagggatgg
tccgcctggtccacctgggaagtactgcgacggctccctgccctccatcaacgactgctt
ctaagctctgatttcgacccctggataaatgattgcataaaacgaatatgtatttccttg
aatcctttgctcttccgtccggcgaacgcgtga

DBGET integrated database retrieval system