KEGG   Drosophila persimilis: Dper_GL16159Help
Entry
Dper_GL16159      CDS       T01063                                 

Definition
(RefSeq) GL16159 gene product from transcript GL16159-RA
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dper_GL16159
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dper_GL16159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys Transglycosylas SLT
Motif
Other DBs
NCBI-GeneID: 6601031
NCBI-ProteinID: XP_002026119
FlyBase: FBgn0153763
UniProt: B4H5I6
AA seq 140 aa AA seqDB search
MKAFIVLVALALAAPAFGRTMDRCSLAREMSDLGVPRDQLDKWTCIAEHESSYRTGVVGP
ENYNGSNDYGIFQINDYYWCAPPTGRFSYNECGLSCNALLTDNIEHSVRCAQKVLSQQGW
SAWSTWHYCSGWLPSIDECF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcatcgttctggttgccctggctctggccgctcccgcttttggtcgcacc
atggaccgttgctccctggcccgcgagatgtccgacctgggcgtcccccgcgatcagctg
gacaagtggacctgcattgccgagcacgagagctcctaccgcaccggagtggtcggaccc
gagaactacaacggctccaacgactacggcatcttccagatcaacgactactactggtgc
gctccccccaccggtcgcttctcctacaacgagtgcggcctgagctgcaatgccctgttg
accgacaacatcgagcactccgtgcgttgcgcccagaaggtcctctcccagcagggatgg
tccgcctggtccacctggcactactgcagcggatggctgccgtccatcgatgagtgcttc
taa

DBGET integrated database retrieval system