KEGG   Drosophila persimilis: Dper_GL16272Help
Entry
Dper_GL16272      CDS       T01063                                 

Definition
GL16272 gene product from transcript GL16272-RA
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
dpe  Drosophila persimilis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dper_GL16272
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dper_GL16272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 216 aa AA seqDB search
MSAPVIVEATAKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF
RMPSWFDLKTLDISGPEDEPGIQAARDNVHGMIQKEISAGIPANRIVLGGFSQGGALALY
SALTYDQPLAGVVALSCWLPLHKKFPGAKLNSEDVPIFQAHGDYDPVVPYKFGQLSASLL
KSFMKNVTFKTYSGLSHSSSDDEMDDVKDIISKWVN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaccggtcattgtcgaggccacggccaagcaaactgccacgttgattttcatg
cacggcctgggggatactgggcacggctggagcagtgcattggccgccatcagacctcct
ttcatgaaggtgatctgtccgacagccccaacacagccagtatcgctaaatgctggcttc
cgcatgccctcctggtttgacctgaagacgctggacatttccgggcccgaggatgagccc
ggcatacaggcagctcgcgacaatgttcacggcatgattcagaaggagatcagcgctggc
attccggccaatcgcatcgtcttgggaggcttttcgcagggcggagccctagctctctat
tcggcgctgacctatgaccagccgctagccggcgttgtggcactctcgtgctggttgccg
ctgcacaagaaattccctggagccaagctgaacagtgaggatgtgccgattttccaagcg
cacggtgactacgacccggtggttccctacaagtttggccagctaagcgccagtctactc
aagtcgttcatgaagaacgtgaccttcaagacctacagtggactctcgcactcgtcgtcc
gatgacgagatggacgacgtgaaggacataatcagtaaatgggtaaactaa

DBGET integrated database retrieval system