KEGG   Drosophila persimilis: Dper_GL16305Help
Entry
Dper_GL16305      CDS       T01063                                 

Definition
GL16305 gene product from transcript GL16305-RA
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dper_GL16305
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dper_GL16305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1576 aa AA seqDB search
MTDKEIEQCTVSVFDQTPGSEEKKINVVVRPHFTVQRVIELIGTQFPCGKFELILQPHEG
KDLVHLNALDTQLLYDVNGFERQQKNHLVLLPSGSWDGDVTKRFELPMKKAQVVVSPKDP
TTKSSDQKSKTSATGEKKKKVGEKTKKKSSSGSSSPRKTKATSEDSASSTKAGASSEESP
KAGGTAEEKPKPSSSSEKSPKTGGCSEDKPKAGSSSEDSPKASSNSEGKPRPGGSSEDRS
KTIAEVKSEDATDVRPEESSDVSPVHAKLVFKEKEKTTSDACYDLPMDELNKAVTHDLMS
PVDDLPSELFNVSPVSDAEPLSDDDLALGASASPTLMGAGYDFGPAVGDGEGSVGEGDQA
AGGEDAGEVSGLSKFYRRKYGGDELPSWQRMNSTAADLVASATTETEPRPTAGPKGYVGL
VNQAMTCYLNSLLQALYMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSPKSSVE
TTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEQKFKNTKQANLISNLYEGKMNDYVKCL
ECNTEKTREDTFLDIPLPVRPFGSNSAYGSIEEALRAFVQPETLDGNNQYLCEKCKKKCD
AHKGLHFKSFPYILTLHLKRFDFDYTSMNRIKLNDRVTFPQTLNLNTFVNRTANGEQYQM
NGGTAAEDCSTADSGSTIEDDNLSSGVGTTASSSQHENDLNDEDEGIDMSSSTSKSAKQG
SGPYMYELFAIMIHSGSASGGHYYAYIKDFDSNEWFCFNDQNVSSITQEDIQRSFGGPNG
SYYSSAYTSSTNAYMLMYRQVDGKRNEHTAKAADFPEHIKTLLPKLHSEEETRVTRIGRH
ITVTDLALPELYKPRVYFYNPSLKKMKITRVYLSQSFDINLVLTSAYEMLNVEQFAPIAR
CRLVAYNSAMDTIIQSLESYTDPALTELRAAQNYNLDFLLEYRAEDQTFETYEPDGITWY
VFMVDLSTMAMDGPFLVYSAAREREPSDVLRHSIAVRLHINEQQFLLSTVRGAVPKAFVV
YDPHPTPEAQQQLQNLANSQFKYITYFYLNVPNTDAASLEMLGVPISECRLEPPPSSGAD
VVDAAMMNGVGSGQDLSCNDSEWRRYKRDLLEPLNQPSHGQESNSEDSSLSDGDRTLVEA
ENITNRGGGDSQVSSTSHSPQLSSPEDEAASHDAMMRVHAYCNGSYTAADAVEPILLPTS
TTHFFHACKVECVDVTSSSSSSHQSDDEAQLRKPTRAYKLLVGTHMRMAAFKQHIEQLIQ
VPSAYFKLQRKHENNVSISQTTSLVYLTEGETLTVEVGKTLQSDEYKAKIQFLRLADVDN
ETSRLPCACEWVYNGSTTVEQAKQELVAKLHRMDTKYSTLTVDNCRMWLKGGRSSIKILA
NDEHLFSDISSTITTEFILQECEEGVDPQPRDDSLTIFVRRWCPSKLEFGKFQEITLEND
SEIRQSLSEISSIAVDKLSYMKVNSNFPCTSISALSVNESTSWYSVPTTRDKYPLSTTQA
GSIFLYKDKSIPVRELTLEERRQIDAREKARLDRLGCVTTTRYSQRRERALKIYVDSSEK
ANNATASAPMDAHVDN
NT seq 4731 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaaggagatcgagcagtgcaccgtttctgtcttcgaccagaccccaggctcg
gaggaaaagaagatcaatgtggtggtgcggccgcattttacggtccagcgggtcatagaa
ctgattggcacccagtttccctgcggaaagtttgagcttattctacagccccacgagggc
aaggatctggtccacttaaacgcattggacactcagctgctgtacgatgtgaacggcttt
gagcgacagcagaagaatcatctggtactgctaccctccggcagctgggatggtgatgtg
accaagcgcttcgagctgcccatgaagaaggctcaggtggtggtcagccccaaggaccca
accaccaagtccagcgatcagaagtccaagacatcagccactggcgagaagaagaaaaag
gtgggcgagaagacaaaaaagaagtcatcatcgggctcatcgtcaccgagaaagacaaag
gcaacgagcgaggactctgcttccagcactaaggcaggggcaagttcagaagagagtcca
aaggccggcggcaccgcagaggagaagccaaagcccagcagcagctcagagaaaagtcca
aagacaggaggctgctcagaggacaagccaaaggcaggaagcagctcagaggatagtcca
aaggcaagtagcaactcagagggcaagccaaggccagggggcagctcagaggacaggtca
aagaccatagctgaggtcaaatcagaggacgctactgatgtcaggccagaagaaagttct
gacgtcagtccggtccatgccaaactagttttcaaggagaaggagaaaactactagcgat
gcctgctacgacctgcccatggacgagttaaacaaggcggtgacacacgatctgatgtcg
cccgtcgacgatctgccctcggaactgttcaacgtgagtcccgtctcggatgctgaacca
ctgtcggacgatgacctggccctgggcgcctcggccagtcccacactgatgggagccggc
tatgactttggaccagcagtcggcgatggtgaggggtcagtcggtgagggtgaccaggca
gccggtggcgaagatgcaggcgaagtttcgggtctgtccaagttctatcggcgcaagtac
ggcggcgacgagctgccctcgtggcagcgcatgaactccacggcggcagatctagtggca
tcggccaccacggagactgagcctcgacccactgctggccccaagggatacgtgggactg
gtgaatcaggccatgacctgctacctgaacagtctgctgcaggcgctctacatgacgcca
gagttcaggaacgccctgtaccggtgggagttcgacaacgacaacgaggcgaaaaacatc
ccatatcagctgcagaagctgttcctcaatctccagacatcgcccaagtcctcggtggag
accacggatctgacgcgcagcttcggctgggactcgacggaagcctggcaacagcacgac
atccaggagctgtgccgtgtcatgttcgatgcattggagcaaaagttcaagaacaccaag
caggcgaatctcatctcgaacctctacgagggcaagatgaacgactacgtgaaatgtttg
gagtgcaatacggagaagacgcgcgaggacaccttcctggacataccgctgccggtgcgt
ccgtttggcagcaactctgcctacggcagcattgaggaggccctgcgcgccttcgtccag
ccagaaacgctcgatgggaacaatcagtatctctgcgagaagtgcaagaagaagtgcgat
gcccacaaggggctgcacttcaagtccttcccctacatcctgacactgcacctgaaacgc
ttcgactttgactacacgtccatgaaccgcatcaagctgaacgacagagtgaccttcccg
cagacgctcaacctgaacacgtttgtcaatcgcactgcaaacggcgaacagtaccaaatg
aacggcggaacagcggcggaagattgcagcacagcggatagcggctccacgatagaggat
gacaatctgagcagcggcgtggggaccacagccagctctagccagcatgagaacgatcta
aatgacgaggacgagggcatcgatatgagcagcagtaccagcaaaagcgccaagcagggc
tcgggaccgtatatgtatgagctttttgccatcatgatccattcggggagtgcctcggga
ggtcattactatgcctacataaaggactttgacagcaacgaatggttctgcttcaacgat
caaaatgtgtcctcaatcacacaggaagatatacaacgctcctttggcggaccaaatggc
agctactactccagcgcttacacttctagcaccaatgcctacatgctgatgtaccgccag
gtggatggcaaacggaacgagcacaccgccaaagctgcagacttccccgagcatatcaag
acgctgctgccaaagctacattcggaggaggaaacgcgagtaacacgcattggacggcac
atcactgttaccgatctggcgctgccggagctgtacaagccacgcgtctacttctacaat
ccctcgctcaagaagatgaagatcacgcgggtctacctgtcccagagctttgacatcaat
ctcgtgctgacttccgcatacgagatgttgaatgtcgaacaatttgcgcccattgcccgc
tgtcgcctggtggcctacaattcggccatggacacgataatccaatcgctggagagctac
accgatccggcgctgacagagctgcgagccgcccaaaactacaatctagacttcctgctg
gagtatcgggccgaggatcagacattcgagacgtacgagccagacggcatcacttggtat
gtgtttatggtagatctatcgacgatggccatggacggtcccttcctggtttactcagca
gcgcgggaacgagagcccagtgacgttctgcgtcactccattgccgtgcggctgcacatc
aacgagcagcagttcctgctttccaccgtacgcggcgctgtacccaaggcttttgtcgta
tacgatccccatcccacacctgaggcgcagcagcagctccagaatctggccaacagccaa
ttcaaatatatcacatatttctatttgaatgtccccaacacagacgccgccagtctcgag
atgttgggcgtgccaattagcgagtgccgcctcgagcctcctcccagcagcggtgcggat
gttgtggatgccgccatgatgaatggcgtgggttccgggcaggatttatcctgcaatgac
tctgagtggcggcgttacaagcgggatttgctggagccgctgaaccagccaagccatggc
caagagtccaattcggaggacagcagcctgagcgatggggatcgcactctggtggaggcc
gaaaacataacgaatcgcggcggtggcgacagtcaagtgagctccaccagtcactcaccg
caattgtctagtcccgaggatgaggccgcctcccacgatgccatgatgcgcgtgcacgcc
tattgcaatggcagctacacggccgcagacgccgtggagcccatcctcctgcccacgagc
acaacgcacttctttcatgcttgcaaggtagagtgcgtggacgtgactagcagctccagt
tcgagccatcagtccgacgacgaggcacagctgaggaaacccacccgcgcctacaaacta
ctggtaggcacccacatgcggatggctgcctttaagcaacacatcgaacagctgatccag
gtgcccagcgcctacttcaagctgcagaggaagcatgaaaacaacgtctctatcagccag
accacctcgctggtctacctcaccgagggcgagaccctgaccgtggaagtgggcaagaca
ctgcagtctgacgagtacaaggcgaagattcagttcttgcgactggccgacgtggacaac
gaaacctcgcgactgccctgcgcctgtgagtgggtatataatggaagcaccacagttgag
caggccaagcaggaactggtggcgaagctgcatcgcatggataccaagtactccaccctc
acggtagacaattgtcgcatgtggttgaagggcggtcgcagctccatcaagatactggca
aacgatgagcacctgtttagcgacataagctctacaatcaccacggagtttattctgcaa
gagtgcgaagagggtgtcgatccgcagccgagggatgattctcttaccatattcgtgagg
cgctggtgtccgagcaagctggagtttggcaaattccaggaaatcaccttggaaaacgac
agcgagataaggcaatcattgtcggagattagcagcatcgcagtcgacaaattgagctac
atgaaggtaaacagtaacttcccctgcacaagcatatcagcgctcagtgtaaacgagtcc
accagctggtactcggtgccgacaaccagggacaagtatccgctaagtaccacacaggcg
ggcagcattttcttgtacaaagataagagcatacccgtgcgagagctgacactggaggag
cggcgccagattgatgcgagggagaaggctcgcctggatcgtctgggttgtgtgaccacc
acacgctactcgcagcgccgcgagcgagctctcaagatatacgtggactcgtcggagaag
gcaaacaacgccacagcctcggcacccatggatgcgcatgttgataattag

DBGET integrated database retrieval system