KEGG   Drosophila persimilis: Dper_GL16307Help
Entry
Dper_GL16307      CDS       T01063                                 

Definition
GL16307 gene product from transcript GL16307-RA
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 530 aa AA seqDB search
MPVSMAVCETANVVNAALRESLGVGNGSRAADEAKKTGGGGGDDSDSEMHNQIAVSAYAK
RILMSKIEYEEVPNYHDSVLEQLKNKYIVIKQPSNNNNNSSSCNGSNFGNSKVVGANGHD
NGNNGHRKLSQSESTQSGPSPNELPKPKRVLYPRENIRIGWKQSERKWQVGTGMINVGNT
CYLNSTLQALFHIPALANWLVSEQTHLENCNITESNGGCIICAMAKTLQSTQSCQSAMRP
FHIYSKLKQICKHMVVGRQEDAHEFLRFLVEAMEKAYLMRFRNFKELDQLVKETTPLNQI
FGGYLRSEVRCLSCSHVSITFQHFQDLLLDIRKSDTLEEAFDGYFSRERLEDMGYKCEGC
KKKVSATKQFSLERAPITLCIQLKRFSMIGNKLTKTISFKPRIDLSRFAARSPAAAAQPL
TYRLVSMVTHLGVSQHCGHYTAIGMTESGSYYNFDDSYVRPIAMQSVCNTNAYIMFYELD
LSQTTPLKSNGLRLTNGHSPVAVPATVSSSSPTHTRFIGPQLPPGGIQWI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtttcgatggctgtatgcgaaacggcgaatgtcgtcaacgctgcgctccgcgaa
tcgcttggcgtcgggaacggcagcagggctgctgacgaggccaaaaaaaccggcggaggc
ggcggcgacgactctgactctgaaatgcataatcaaattgctgtcagtgcgtatgcaaag
cggattctaatgtccaaaatcgagtacgaggaggtccccaactaccacgactcggtgctg
gagcagttgaagaacaagtacatagtcatcaagcaacccagcaacaacaacaacaacagc
agcagctgcaacgggagcaactttggcaacagcaaagttgtgggagcaaatggacacgac
aatgggaataatggccatcgcaagctgtcccagtcagagtccacccaatcgggtcccagt
cccaacgagctgccaaaaccaaagcgcgtcctctatccccgagagaacatcaggatcggg
tggaagcaatcggagcgcaagtggcaggtcggcacgggcatgataaatgtgggcaacacc
tgctaccttaactcaacgctgcaggccctcttccacatacccgcattggccaactggctc
gtctcggagcagacgcatctggagaactgcaacataaccgagtccaatggcggttgcatc
atctgcgccatggccaagacactacagtcgacgcagtcctgccagtcggccatgcgtccg
ttccacatctactcgaagctgaagcagatctgcaagcacatggtggtgggacggcaggag
gatgcacacgagttcctgcgcttcctggtggaggccatggagaaggcgtacttgatgcgt
ttccgcaacttcaaggagctagatcagctggtgaaggagacgacgccactgaatcagata
ttcggtggctacctgcgcagcgaggtgcgttgcctcagctgcagccacgtctcaatcacc
ttccagcacttccaggaccttctgctcgatatacgcaagtcggacacgctcgaggaggcg
ttcgacggttacttctcgagggagcgactcgaagacatgggatacaagtgtgagggctgc
aaaaagaaggtctcggccaccaaacagttcagcctggagcgggccccaatcacgctgtgc
atccagctgaagcgcttctcgatgatcggcaacaagctgaccaagacgatcagcttcaag
ccacgcattgacctgagtaggtttgctgcccgctcgccggcggctgccgcccagccgctc
acctaccgcctcgtctccatggtcacacacctgggagtctctcagcactgcggccactat
acggccatcggtatgaccgagtcgggcagctactacaactttgatgacagctacgtgcgc
cccattgccatgcagagtgtgtgcaacaccaacgcctacatcatgttctacgagctggat
ctgtcacagaccactccgctcaagagcaatggcttgcgtctgaccaatggccacagtcca
gtggctgtcccagccacagtctcctcctcctcacccacgcatacacgtttcattggaccc
cagctgccgccaggcggtatccaatggatatag

DBGET integrated database retrieval system