KEGG   Drosophila persimilis: Dper_GL16350Help
Entry
Dper_GL16350      CDS       T01063                                 

Definition
GL16350 gene product from transcript GL16350-RA
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dpe  Drosophila persimilis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:dpe00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 189 aa AA seqDB search
MVKVWFMDDEQETDQRLEHHRSPPDYLELPELYQKTGVEYFKACINADDYQNDAILGELR
AKRGYTYDDEITCSEKCLPDYANKLKNFFTEHLHTDEEIRLVLDGSGYFDVRDNEEQWLR
IQVVKGDLIIIPAGIYHRFTLDSNNFIKARRYFVGEPVWTPHNRPADDLDCRKSYLKHQA
ESFVQLNQV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagtatggtttatggacgacgagcaggagaccgatcagcgactggagcatcat
cgcagtccgccggactatctggagcttcctgaactgtaccagaagacgggcgtggaatat
ttcaaggcatgtatcaacgctgacgattaccaaaacgacgcgattctaggggagctgcgg
gccaaacgtggctatacctacgatgatgagatcacctgctcggagaagtgccttccggac
tacgccaataagctgaagaacttttttacggaacatctgcatacggacgaggagatacgt
ttggtattggatggatcgggctactttgatgtccgcgacaacgaggagcagtggctgaga
atacaagtggttaaaggagatttgattattattccggctggtatctatcatcgtttcacg
ttggactctaataactttatcaaagcccgtcgctattttgttggagagcccgtctggacc
ccgcataatcgtcctgcagatgatttggattgccgcaagtcctacctgaagcatcaagct
gagagttttgtgcaattaaaccaggtctaa

DBGET integrated database retrieval system