KEGG   Drosophila persimilis: Dper_GL16430Help
Entry
Dper_GL16430      CDS       T01063                                 

Definition
GL16430 gene product from transcript GL16430-RA
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 447 aa AA seqDB search
MARVNIKEELISSSSTTSENSDADIEDNLVEGNGNDQGQGQDQRGRRRLIIRFIRARRQQ
QQQQPLGEKRDDTPENMDKDSLEEDENDSGIATSPLPSGISKTTTTTTTTTSAANNNEAS
RSPQQQREQKKEDGRSSADIVTAGVSAVGASSIRQISIDLDLPPNGVVREEAGEANTDKV
AKLQLQEIATQLALTSLPVELMPGQNKVGCDSCTQRLNGNDPKAKSVNTNATKQLLVSSP
PAVLILHLKRFQLGPRCIFRKLTRPVSYPNMLDIAAFCGSKVKNLPNIDRKQKKLLYALY
GVVEHSGGMYGGHYTAYVKVRPKVTPEDKRWKFLPHGSKAELDQDDDQLKKLEELLAKEK
ARELHLNSMNDSDDFTNSSSNSSTSEEFNTNPNGLGPGQQDKQEEEAANVQAPPGKWYYV
SDSRVQEVSEDTALKAQAYLLFYERIY
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggccagggtcaacataaaggaggagctaatatcctcgagctccaccacatcggagaat
tcagacgccgatatcgaggataatctggtggaaggaaacggcaacgaccagggacagggc
caagaccagaggggtcgccggcggctcatcatccgcttcatccgcgcaaggaggcaacag
cagcagcagcagccgttgggcgagaagcgggatgacacgccggagaacatggacaaggac
tccctcgaagaggacgagaacgactcaggcatagccaccagtccgttgcccagcggcatc
agtaaaacgacgacgaccaccaccactaccacctccgccgccaacaacaatgaggcctcc
agaagtccacagcagcagcgggagcagaagaaggaggacggccgatcctctgcggacata
gtcacagcaggcgtgagcgcagtgggagcctcctccatacggcaaatctctattgatttg
gacctgccaccgaacggagtcgtccgagaagaggcgggagaggcgaatacggataaggtt
gctaagctccagctgcaggagatagccacccaactggctttaacttcactgcccgtcgag
ctgatgcccggccagaacaaggtgggctgcgacagctgcacgcagcgtctgaatgggaac
gatccgaaggccaagtcggtcaatacgaacgccaccaagcagctgctggtgtccagcccg
ccggcggtgctcatcctacacctgaagcgcttccagctgggtccgcgctgcatattccga
aagctgacgcggccggtcagctacccaaacatgctggacattgccgccttctgcgggtcc
aaggttaagaatctgcccaatatcgatcgcaagcagaagaaactactgtacgctctatac
ggggtggtggaacactcgggcggcatgtacggcggtcactacaccgcctacgtgaaggtg
cggcccaaggtgacgccagaggacaaacgctggaagttcctgccgcacggcagcaaggcc
gagctcgaccaggacgacgatcagctgaagaagctggaagagttgcttgcgaaggagaag
gcgcgcgagctgcacttgaactcgatgaacgacagcgacgacttcaccaactctagcagc
aattcatctacctctgaggagttcaataccaatcccaatggactcggacccggccagcag
gataagcaggaggaggaggctgccaatgtccaggcgccgccaggaaaatggtattacgta
tcagactcgcgggttcaggaggttagcgaggacacggcgctcaaggcccaggcctatctg
ctcttctacgagcgcatctactaa

DBGET integrated database retrieval system