KEGG   Drosophila persimilis: Dper_GL16492Help
Entry
Dper_GL16492      CDS       T01063                                 

Definition
GL16492 gene product from transcript GL16492-RA
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
dpe  Drosophila persimilis
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dpe04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1227 aa AA seqDB search
MSTIEFETIGSRLQSLEAALQAQNESHEQIVLSRPRGGSSGVSGGSSSLARVQPAPAAPG
SLAATSTTVGSAISIASRPAPPVPQPAQAPTAGVYGGTFIPPTTRSPRPTPNLPLSEAGT
NRRRMILSLPTQPHPSETETDKKLKIIMAQTGKLNINGRQYPTDIHDLRHLGDLGNGTSG
NVVKMLHVSSDTIIAVKQMRRTGNAEENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDV
WICMELMSMCFDKLLKLSKKPVPECILGKVTVATVNALSYLKDKHGVIHRDVKPSNILID
ERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDPKKPKYDIRADVWSLGITLVEL
ATARSPYEGCNTDFEVLTKVLDSEPPCLPSGEGFNFSHEFHDFVIKCLTKNHQDRPKYPE
LLVQPFIRTYETTKVDVPNWFQMVMETAGKRLRVNGDPTLKRPTTTTTGAATTVGNGAAG
EPGSGAPTAASVMGPGSGAAPTKYGRAAISYQAPSTMNPQKTIKPTQIPSYQQPQAHQQQ
QQQSQSQSQYFIQSATQLPQTTTTKATTTAGTTTNCFGHSGGSRSGSSSASPLSPASGLS
ASPLSPPSGGISASPLSPPGGISDISKLYRKSPFMQRKLSNGNPHHYQQQHYKYSDESPK
KESMFSSIGQSILRNLTTSPFSQKKHHSTSSSSASTTPTATKSTGITTLPHNNQTATTTD
KTASAAPTSTPTTTTTTATAKAPSTPQWRLPEDSPLAYDSCDSSSNVNVNANANASTLTL
GLSSPSPSLQRRPFPTEIQTQAATTGSSVTLQLNSQLQQQQQQQPQRLQPGNQSPIVLQR
FYHQQNQLREKEAAERYQQQRQQPVGGTSTNPFHSNYVPPPPSTHSTSSQSSTQSTCSQI
AAPLASLSPPGATAAAGHFRVGSAEQLQYQPLPLTTAEVATSPRSPEQPQPQPLHHQQQH
PQLEYGGGGGGGGGGGGGGGVGGSMVASKLSKLYARRQLLGQSSSSRASSNSLDAKEQHD
AGWFNTLAGAMKRQFATYVKTQLNSTATSPVLQSQPQMQSQVQPPAYRSVVNNGGGGKAY
YYRTLSAASSSSNTSQSTSPTTEPLASSAGFLRRYASSGAGPGGGGSISTPPSPHILAGL
DRRHRSPDPPPRYNRGQSPLLLRKNLLELSGQPPGSPLLHRRYVSASPPLPPPRRGSESV
PGSPQHFRTRIHYTPEPQRRIYRTIDQ
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccatcgaattcgaaacgattggcagccgactgcagtcgctggaggctgcgctg
caggcgcagaacgaatcccatgaacaaatcgtcttatcgaggccgcgcggcggcagcagc
ggcgtcagcggaggctcctcatcgctggcgcgtgtccaaccagcaccggcagcccccggc
agccttgccgccacctccaccacagttggatcggccatcagcatagcctctagacccgcg
ccaccagttcctcagccagcgcaggcccccacagcgggcgtctatggcggcacctttatc
ccgcccaccaccaggagtccgcgtcccactccaaacctgccactgtccgaggctggcacg
aatcggcgccgtatgatcctgtcgctgcccacacagccgcacccctcagaaacggagacg
gacaagaagctgaagatcatcatggcccagacgggcaagctgaacataaacgggcgccag
tacccgacggacatccacgatctgcggcacctgggcgacctggggaacggaaccagtggc
aatgtggtgaagatgctgcatgtgtccagcgatacgatcattgccgtgaagcaaatgcgg
cgcacgggcaacgcggaggagaacaagcgcatcctgatggatctggatgtggtgctcaag
tcccacgactgcaaatacattgtcaagtgcctcggctgctttgtgcgcgaccccgacgtg
tggatctgcatggagctgatgtccatgtgcttcgacaagctgctcaaactctccaagaag
ccggtgcccgagtgcattctcggcaaggtcacagtggcgacggtcaacgccctgtcgtat
ctgaaggacaagcacggggtcatccatcgggacgtgaagccctcgaacatactgatcgac
gagcgcggcaacatcaagctctgcgactttgggatcagcggtcgtttggtggactccaag
gccaacacgcgctcggctggctgtgcggcgtacatggcgccggaacgaatcgatccaaag
aaaccaaagtatgacatacgcgccgatgtctggtcgctgggcatcacgctcgtggagctg
gccactgcgcgatccccctacgaaggctgcaacacggactttgaggtgctcaccaaagtg
ctggactcggagccgccctgcctgcccagcggcgagggcttcaattttagtcacgagttt
cacgattttgtcatcaagtgcctcacaaagaaccatcaggatcgacccaagtacccggag
ctcctggttcaaccgttcataaggacctatgagacaaccaaagtagatgttccaaactgg
tttcagatggtcatggagacggccggcaagcggctgcgcgtcaatggcgatcccacgctg
aagagaccaacaacaacaacaacaggagcggcaacaacagttggaaatggtgcagccgga
gaaccaggatcaggagctccaacagcagcatcagtgatgggaccaggatcaggagcagcc
ccaacaaaatacggcagagcggcaatatcctaccaagctccgagcaccatgaatccacag
aagacaataaaacccacgcagataccaagctaccagcaaccacaggcgcatcagcaacag
caacagcagtcgcagtcgcagtcgcagtatttcatacaatcagccacacaactacctcaa
acaacaacaacaaaagcaacaacgacagcaggaacaaccacaaactgcttcgggcacagc
ggtgggagcaggagcggtagcagcagtgccagcccactgtcgccggccagtgggctaagc
gccagcccgctgtcgccgccgagtggaggcatcagcgccagtccactttcgccgcccggt
ggcatcagcgacataagcaaactgtatcggaagtcgcccttcatgcagcggaagctgagc
aacggaaaccctcatcattatcagcagcagcactacaaatacagcgatgagagccccaag
aaggagtcgatgttcagcagtattggccaatcgattctacgcaatctgacgacatcgccc
ttcagccaaaagaaacaccattcaacatcgtcatcgtcggcatcgacgacaccaacagca
acaaaatcaacaggaataacaacactgccgcacaacaaccaaaccgcaacaaccacggat
aaaacagcatcagcagcgccaacgtcaacgcccacaacaacaacaacaacagcgacagcg
aaagcacccagcacgccccaatggcgactgccagaggatagtcccttagcctacgacagc
tgtgatagtagtagtaatgtgaatgtgaatgcgaatgcgaatgcgagtaccctgaccttg
ggcctatcctccccctcgccatcgctgcagcgcaggccatttcccacagagatacaaacg
caggcggcaacaacaggctcgtcggtgaccttgcagctgaacagccaactgcagcagcag
cagcagcaacaaccacagcgcctgcagccaggaaatcaaagccccatagtattgcaacgc
ttctaccatcagcagaaccagctccgcgagaaggaggccgccgagcggtaccaacagcag
cgccagcagccagtcggcggcaccagcacgaatccattccacagcaactacgtgccgccg
ccgccctcgacgcactccacatctagtcagtcgtccacgcagtcgacgtgctcgcagatt
gcggcccccctcgccagcctatcgccgcccggagcgacggcggcagcgggacactttagg
gtgggcagtgcggagcagctgcagtaccagccgctgcccctaacgacggcggaggtggcc
acaagtcccagatctccagagcagccgcaaccgcagcccctgcaccaccagcagcagcat
ccacagctggagtatggcggtgggggaggcggtggcggtggcgggggcggtggcggtggc
gttgggggatcgatggtggccagcaagctgagcaagctgtatgcccgccggcagcttttg
ggccagagctcgagcagcagggcgagcagcaacagcctggacgcgaaggagcagcacgat
gcgggctggttcaacactctcgccggcgccatgaagcgacaatttgccacctatgttaaa
acccaattgaattccacagccacgtcaccagtgttgcagtcgcagccacaaatgcagtcg
caggtacagccgccggcctacaggagtgtcgtgaacaacggaggaggcggcaaggcctac
tactatcgcaccctctccgcggcgagcagcagcagcaacaccagccagagcacctcccct
accacggagccgctggccagcagcgctggcttcctgcggcgctatgccagcagcggtgcc
ggtcccggaggcggaggcagcatcagcacaccccccagtccgcacatcctcgccggactg
gatcgcaggcaccgcagtccggacccgccgccacgctacaatcgcggccagtcgccgttg
ctgctacgcaagaatctgctagagctgagtggacagccgccgggctcccccctgctccat
agacgatatgtgtcggcgtcgccgccgttgcccccgccgcgacgcggctctgagagcgtg
cccggatcgccacagcacttccgcacccgcatccactacacccccgagccccagagacgc
atctatcgcaccatagatcaatga

DBGET integrated database retrieval system