KEGG   Drosophila persimilis: Dper_GL16493Help
Entry
Dper_GL16493      CDS       T01063                                 

Definition
GL16493 gene product from transcript GL16493-RA
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dpe  Drosophila persimilis
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dper_GL16493
   04068 FoxO signaling pathway
    Dper_GL16493
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dper_GL16493
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dper_GL16493
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dper_GL16493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 396 aa AA seqDB search
MSKNKLNLVLPPVNTEATVAAAQVAPTPPFKTPSGTETHSLLGKPKTSIDALTETLEGLD
MDDTERKRIKVFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTNLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDKHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLASMFADKVED
SNQPVDEPRAMAIFELLDYIVNEPPPKLEHETFSSEFKDFVDICLKKQPDERADLKTLLS
HPWIRKAEVEEVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaagctgaacctggtgctgccgccggtgaatacggaggcaactgttgca
gccgcacaagtggctccaacgccgccatttaaaacaccatcgggcacagaaacacatagc
ctgctgggaaagccaaaaacgagcattgatgcgttaactgagactctagaaggactggac
atggacgacacggagcgcaagcggataaaagtctttcttagccagaaggagaagattggc
gaactttcggacgaggacctggagaagctgggcgaactgggctccgggaacggcggcgta
gtcatgaaagtccgacacacgcacacaaacctgataatggcgaggaagcttattcatctg
gaggtgaagccggccatcaagaagcaaatcctacgcgaactaaaggtcctacacgagtgc
aacttcccacacattgtcggcttctatggcgccttctacagcgacggtgagattagcata
tgcatggagtacatggacggcggctcactcgatctcatactgaagcgggccggtagaata
cccgagtcgatcctgggacgcatcacgctcgccgttctgaaaggccttagttatctgcgg
gacaagcacgccatcatccaccgggatgtgaagccgagcaacatcctggtcaatagcagc
ggagagataaagatctgtgatttcggagtgtctggccagctgattgactcaatggccaac
tcgtttgtgggcacgcgcagctacatgtcaccggaacgtctgcagggcactcactactca
gtacagtcggacatttggtcgctgggactgtcgctggtggagatggccatcggcatgtat
ccgataccgccgccaaacaccgccactttagcgtctatgtttgccgacaaagtcgaggat
agcaatcagcccgtagatgagccgagggcgatggccatcttcgagctgctcgactatata
gtaaatgaaccgccacccaagctggagcatgagacattctcaagcgagttcaaggacttt
gtcgacatctgtctcaagaagcagcccgacgagcgggccgatctcaagactctgctgagt
catccgtggatacgcaaggcggaggtggaggaggtggatatatcaggatgggtgtgtaag
acaatggacctgccgccgtcgacaccaaaacgcaatacttcgcccaactaa

DBGET integrated database retrieval system