KEGG   Drosophila persimilis: Dper_GL16513Help
Entry
Dper_GL16513      CDS       T01063                                 

Definition
GL16513 gene product from transcript GL16513-RA
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dper_GL16513
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dper_GL16513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 667 aa AA seqDB search
MANKSKTESNYELDKNVTAIFDVRKALGKGAYGIVWKAIDKRQRDTVALKKIYDAFRDTT
DAQRTYREVIFLRAFRHHPNIIRLLGIYRATNNMDFYLVFEHMESDLHIVIKKRDILKDI
HRQFVMYQLVNAIKYVHSGNVIHRDLKPSNILIDSKCRLKVGDFGLARTVLVKPSERGTG
DATGLHDAPTENDGMMSDYVATRWYRAPEILVGCRRYTKAVDMWSLGCILGEMITEQPIF
QGSSTINQMEKILSALPNVTQREIDDIGTRFGTSLLCRSIRRDYQHSLNAMCRGCDSDEI
GFTTSLLMLDPKDRITANKALKHPFVSSFRCPSAEMEMRLNVQPPLRDDYRFALDDYRNS
LYGMISKELGTGHRITQSCRTPTTVPRDSAALRELPFGCRTRRSDNTRNEKSFLLEALLR
RKQRETNSLDPDMDAKVQANLDRLQAERKKMQKKILKYAAETGLMIINENSKNNGSDRSK
TVYSSDSEAYFTPTSRKTVVKKTLIKKYNGNRDVKHHGNNITELHESTSSYKFKKQQHDV
FDASEKGEQQVGDAKDFLEAKYCLTHELPRHEMEKDRYDSIIPSGVRHSPDDSFNTRPTP
GKQHTILKPMYLDLFSTLASAPAPVQTLLSSHTVKEPRRRKHISGDNFQPLHQRHISEIQ
ATRINDD
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaaatcaaagacggaatccaactatgaactggacaagaacgtgacggcaatt
ttcgatgtgcgaaaggccttgggcaagggtgcctatgggattgtgtggaaggccatcgac
aagcggcaaagggatacagtggccctgaagaagatctacgatgcgtttcgcgacacgacc
gatgcccagcgcacatatcgggaggtgatcttcctgcgggcctttcgccatcatccgaac
atcatccgactcttggggatatacagggccaccaacaatatggacttctatttggtgttc
gagcacatggaaagcgatctgcacattgtcatcaagaagagggacatcctcaaggacatc
cacaggcagttcgtaatgtaccagttggtcaatgccataaagtacgttcattcgggcaac
gtcatccacagggatctgaagcccagcaacatactgatcgacagcaagtgcagactgaag
gtgggggactttggactggcgcgcacggttttggtaaagcccagcgaaagagggactggc
gacgccaccggcctccacgacgcccctactgagaatgatggcatgatgtccgactacgtg
gccacgcgctggtatcgtgcccccgagatactcgtgggttgtcgcaggtacactaaggcc
gtcgatatgtggagtctgggctgcatcctgggcgagatgataaccgaacaaccgatcttc
cagggcagcagcaccatcaatcagatggagaaaatattgtctgccctgccgaatgtgacc
cagcgtgagatagacgatattggaacccgattcgggacttcgctgctctgccggtcgatc
cgacgcgactaccagcactccctgaacgccatgtgtcgcggctgcgactccgacgagatt
ggtttcaccacctcgctgctgatgctcgatccgaaagaccggatcacggccaacaaggcc
ctcaagcatccgtttgtgagctcctttcgttgcccctcggcggagatggaaatgcgactg
aatgtgcagccgccgctgcgcgacgattaccgcttcgcgctggacgactatcgtaacagt
ctgtacgggatgatctccaaggagttgggtaccggccatcgcattacccagtcctgtagg
accccgaccacggtgccaagggattcagctgctctacgggaactgcccttcgggtgccga
accaggcgctcggacaacacaaggaacgagaagagctttcttctcgaggcactgctgcgg
cggaaacagcgcgaaacaaattccctggatcccgatatggatgccaaagtgcaagcgaat
ttggatagactccaggccgagaggaaaaagatgcagaagaagatccttaagtatgcggcg
gaaaccggactgatgatcatcaacgaaaattcgaagaataacggctcagaccgctccaaa
acggtatattcttcagactccgaggcctattttacacccacatctcgtaagacggtggta
aagaagacactgattaagaaatataacggcaaccgggacgtaaagcaccacggaaataac
attacggagctccacgaatccacctcgtcctacaagttcaagaaacagcagcacgatgtc
ttcgatgcatcggaaaaaggcgagcagcaggtgggcgacgctaaagattttttggaggca
aagtactgcctaacccatgagctccctcgccacgagatggaaaaagatagatacgattcc
ataatcccttcaggagttcgccactcgccagacgattcattcaacactagacctacacct
ggcaaacagcacacaatcctgaagcccatgtatttggatttgttttcgactctggcatcg
gcaccggctccggtacagaccctgctctcgagccacacagtgaaggagccccgtcgcagg
aagcatatttctggagataacttccagcccctgcatcagcgacacatcagcgagatccag
gcgactcgcatcaatgacgactag

DBGET integrated database retrieval system