KEGG   Drosophila persimilis: Dper_GL16519Help
Entry
Dper_GL16519      CDS       T01063                                 

Definition
(RefSeq) GL16519 gene product from transcript GL16519-RA
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
dpe  Drosophila persimilis
Pathway
dpe04013  MAPK signaling pathway - fly
dpe04624  Toll and Imd signaling pathway
Module
dpe_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dper_GL16519
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dper_GL16519
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dper_GL16519
Protein kinases [BR:dpe01001]
 Serine/threonine kinases: STE group
  STE7 family
   Dper_GL16519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 Choline_kinase APH
Motif
Other DBs
NCBI-GeneID: 6597693
NCBI-ProteinID: XP_002022874
FlyBase: FBgn0154123
UniProt: B4GW95
AA seq 338 aa AA seqDB search
MSRPRPRPQPISIHREPEQALVPPRNLDSRATIQIGDQTFDIDADSLERICDLGRGAYGI
VEKMRHRQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVW
ICMEVMSTSLDKFYPKVFKHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNIL
INRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIS
MIEMATGRYPYDNWRTPFEQLRQVVEDDPPRLPAGTFSPEFEDFIATSLQKEYMARPNYE
QLLKHSFIVEHLQRNTDISEFVARILDLPDEQPQQPTK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaccacgtccgcgtcctcaacccatcagtatccaccgcgagccggaacaagct
cttgtcccgccacggaacctggactcccgtgccaccatccagatcggggaccagaccttc
gacatagatgccgacagtctggagcgaatctgtgatctgggacgaggtgcctacggcatt
gtggagaagatgcgacatcgccagacggacacagtgctggcagtaaagcgtataccgatg
accgtcaatatacgggagcagcatcgtctggtcatggacctggacatatcgatgcgatcc
agcgactgcccctacacggttcacttctatggggcgatgtaccgcgagggcgacgtctgg
atctgcatggaggtgatgagcaccagtctggacaagttttatccgaaggtcttcaagcac
gacctgcgcatggaggagagtgtgctgggaaagattgccatgagcgtggtcagtgctctc
cactatctgcacgcccaactgaaggtcatccatagagatgtgaagccttcgaacatactg
atcaatcgcgccggccaagtgaagatctgtgactttggcatctcaggttatctggtggac
tctattgccaagacaatcgatgccggctgtaagccgtacatggcccccgagcgcatcgac
ccacaagggaatcctgcacagtacgacatacgctccgatgtgtggtcgctgggcataagc
atgattgaaatggccaccggccgctatccgtacgacaattggcggacgccattcgagcaa
ctgcgacaggtggttgaagacgatccacccaggctgccagcgggcacattctcgcccgaa
ttcgaagactttatcgccaccagcctgcagaaggaatatatggcgcggcccaactacgag
cagctgctgaagcacagcttcattgtggagcatctgcagcgcaatacggacatttccgag
tttgtggccaggatactggatttgccggacgaacagccgcagcagccgacaaagtag

DBGET integrated database retrieval system