KEGG   Drosophila persimilis: Dper_GL16601Help
Entry
Dper_GL16601      CDS       T01063                                 

Definition
(RefSeq) GL16601 gene product from transcript GL16601-RA
Organism
dpe  Drosophila persimilis
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
AA seq 419 aa AA seqDB search
MPGTCHVFRRQTLPPPLVLLFAGLLLLGDGIAVQGLHRHSIMMKTFRYLQETMLRNSLER
AHLNHGIVFECRTISDRDFGNEVHFLLQLGDLRGFRQLDASKKLALFLHGWNDKGSKDWV
QELLLTWTLFDASYNVCVVDWGNLSQNDYKTASMSIFDVGLTVAGIIMALEELRPSQFHR
SNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVSPKYRLDPSDAKFVQ
VLHTSGGSLGTSLKCGHADFYPNGGRAPQTNCKMFMNLRDMQNTNPIACSHSAAAIFFRQ
SMDPQYPFVGYECGSYREFAAGYCDQNRRARFGIHSQRRAQGSFYFTTASQQPYVQRRLG
GWLSGVGRQVDSTSASGQKKNGPGQLMLRLWTSGWRRGASRTRERRRERSRQRDLCRWQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcacgtgtcacgtgttccgccggcagaccttgccgcctcctctggtgctgctc
tttgccggcctgctgctcctcggcgatggcattgctgtgcagggccttcaccgccacagc
atcatgatgaaaaccttccgctatctgcaggagaccatgctgcggaacagcctggagcgg
gcccatctcaatcatggcattgtctttgaatgccgcaccatttcggacagggactttggc
aacgaggtgcacttccttctgcagttgggggatcttcggggcttccgacagctggatgcc
tccaagaagctggccctcttcctgcatggctggaacgacaaaggcagcaaggactgggtg
caggagctgttgctgacatggaccctttttgatgccagctacaacgtgtgcgtcgtggac
tggggaaatctgtcgcagaacgactacaagaccgcttctatgtccatcttcgatgtgggc
ctcacggtggccgggatcatcatggccctggaggagctgcgtcccagccagttccatcgc
agcaacgttaccctggccggctacagtctgggggcccatgcagccggctatgccggagcg
gtgctcgagggccaggtggagcagatcatcggcctggatccggccggaccgctcttctcg
ctgcccgccgaggtctcgcccaagtaccggctggaccccagcgatgccaagttcgtgcag
gtgctgcacacctccggcggctccttggggacgagcctcaagtgcgggcatgccgacttc
tatccgaacggtggccgggcaccgcagacgaactgcaagatgttcatgaatctccgcgac
atgcagaacacaaatcccattgcctgcagccattcagcggctgccatctttttccgacag
tcgatggacccgcagtaccccttcgtgggctacgagtgcggcagctaccgggagttcgcc
gccggatattgcgaccagaaccgacgggcccgtttcggcatccactcgcagaggagggcg
caggggagcttctacttcacgaccgcctcccagcagccctatgtgcagcggcggctgggt
ggttggctgagcggcgtggggcggcaggtggactccacctccgcctctggccagaagaag
aatggtccaggtcagctcatgctgcgcctctggacgagcggttggcggaggggcgccagt
cgcactcgggagcggagacgagagcggagccgacaaagagatctgtgtcggtggcagtag

DBGET integrated database retrieval system