KEGG   Drosophila persimilis: Dper_GL16601Help
Entry
Dper_GL16601      CDS       T01063                                 

Definition
GL16601 gene product from transcript GL16601-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dpe  Drosophila persimilis
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dper_GL16601
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dper_GL16601
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dper_GL16601
  Exosomal proteins of breast milk
   Dper_GL16601
Heparan sulfate/heparin binding proteins [BR:dpe00536]
 Enzymes (General comment) Variety
  Dper_GL16601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 419 aa AA seqDB search
MPGTCHVFRRQTLPPPLVLLFAGLLLLGDGIAVQGLHRHSIMMKTFRYLQETMLRNSLER
AHLNHGIVFECRTISDRDFGNEVHFLLQLGDLRGFRQLDASKKLALFLHGWNDKGSKDWV
QELLLTWTLFDASYNVCVVDWGNLSQNDYKTASMSIFDVGLTVAGIIMALEELRPSQFHR
SNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVSPKYRLDPSDAKFVQ
VLHTSGGSLGTSLKCGHADFYPNGGRAPQTNCKMFMNLRDMQNTNPIACSHSAAAIFFRQ
SMDPQYPFVGYECGSYREFAAGYCDQNRRARFGIHSQRRAQGSFYFTTASQQPYVQRRLG
GWLSGVGRQVDSTSASGQKKNGPGQLMLRLWTSGWRRGASRTRERRRERSRQRDLCRWQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcacgtgtcacgtgttccgccggcagaccttgccgcctcctctggtgctgctc
tttgccggcctgctgctcctcggcgatggcattgctgtgcagggccttcaccgccacagc
atcatgatgaaaaccttccgctatctgcaggagaccatgctgcggaacagcctggagcgg
gcccatctcaatcatggcattgtctttgaatgccgcaccatttcggacagggactttggc
aacgaggtgcacttccttctgcagttgggggatcttcggggcttccgacagctggatgcc
tccaagaagctggccctcttcctgcatggctggaacgacaaaggcagcaaggactgggtg
caggagctgttgctgacatggaccctttttgatgccagctacaacgtgtgcgtcgtggac
tggggaaatctgtcgcagaacgactacaagaccgcttctatgtccatcttcgatgtgggc
ctcacggtggccgggatcatcatggccctggaggagctgcgtcccagccagttccatcgc
agcaacgttaccctggccggctacagtctgggggcccatgcagccggctatgccggagcg
gtgctcgagggccaggtggagcagatcatcggcctggatccggccggaccgctcttctcg
ctgcccgccgaggtctcgcccaagtaccggctggaccccagcgatgccaagttcgtgcag
gtgctgcacacctccggcggctccttggggacgagcctcaagtgcgggcatgccgacttc
tatccgaacggtggccgggcaccgcagacgaactgcaagatgttcatgaatctccgcgac
atgcagaacacaaatcccattgcctgcagccattcagcggctgccatctttttccgacag
tcgatggacccgcagtaccccttcgtgggctacgagtgcggcagctaccgggagttcgcc
gccggatattgcgaccagaaccgacgggcccgtttcggcatccactcgcagaggagggcg
caggggagcttctacttcacgaccgcctcccagcagccctatgtgcagcggcggctgggt
ggttggctgagcggcgtggggcggcaggtggactccacctccgcctctggccagaagaag
aatggtccaggtcagctcatgctgcgcctctggacgagcggttggcggaggggcgccagt
cgcactcgggagcggagacgagagcggagccgacaaagagatctgtgtcggtggcagtag

DBGET integrated database retrieval system