KEGG   Drosophila persimilis: Dper_GL16765Help
Entry
Dper_GL16765      CDS       T01063                                 

Definition
GL16765 gene product from transcript GL16765-RA
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dpe  Drosophila persimilis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dper_GL16765
Translation factors [BR:dpe03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dper_GL16765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 240 aa AA seqDB search
MADDWESAADSEIILQNAASTVNKWEGEDDDDDVKESWEDEEEKKDEENEKPTITDVPVK
TKPSKALKAKLEEQARLEEEKEAKRLASLTPEEKLAEKLRLQKIQEDSDLNHALDTFGVT
RAETNGNGLDSFNPETKEQFKEFGSALSWKVGQYRESAEFPQFVEDLVRGLCIHLSAADI
KKVKMSVEILHSEKLKMEKAIAKKAAGKNKGKATLRTESDDIDDYKKYGNDFSEDYDDFM
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgactgggaatctgcagccgacagtgaaatcatacttcaaaatgcagcaagc
accgtaaacaagtgggagggggaggacgacgacgacgatgtgaaggagagctgggaagat
gaggaggagaagaaggacgaggagaacgagaagcccacaataacagatgtgccagtcaaa
accaagccaagcaaagcgctgaaagccaaactagaagaacaagcgcggcttgaagaggag
aaggaagcgaaacggctggccagcctcacacccgaggagaaattggccgagaagctgcgg
ttgcaaaagatccaggaagactccgatttgaaccacgccctggacacattcggagtgacg
cgtgcagaaacaaacggcaacggcctagactccttcaacccggagaccaaggagcagttc
aaggagttcggttctgcgctcagctggaaggtcggccagtatcgcgagtctgcggaattc
ccacaattcgtcgaagacctagtgcgcggtctatgcatacacctgagcgccgctgacatt
aagaaggtcaagatgagcgtggaaatcttgcactcagaaaaactcaaaatggaaaaggcc
attgccaagaaagccgccggcaagaacaagggaaaggccacgcttcgcacagagagcgat
gatattgatgattacaaaaagtatggcaatgatttttccgaagattacgatgacttcatg
tga

DBGET integrated database retrieval system