KEGG   Drosophila persimilis: Dper_GL16769Help
Entry
Dper_GL16769      CDS       T01063                                 

Definition
GL16769 gene product from transcript GL16769-RA
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1292 aa AA seqDB search
MGTTKEQQNEGDAAAEAAVGATHTTPTQHQRKETEEEEEKTLPTPPVVASTMATNAAKKI
RRAFSMPRNPFRWSRKFKTAAAAAAIASDAESGAGKDNAGERRGSHTAISSCVSGGRGRS
GSIISLSSYEAAPGDAAATTTTNTYANSNSNHTNNSTSNSNKRARVLRRSSFKKFLNRIA
QHLSATVNVGSEEQSSAAASRVNLIDIVPFYTGCWRRKEANKHRQTNGLGSASSGGGGDR
VPPIGGYQWPPDQTPGVMGLKNHGNTCFMNAVLQCLSHTDILAEYFVLDQYKADLKRRNK
INSRKFGTKGELTEQLANVLKALWTCRNESDHSTGFKAVVDRYGTQFRSSTQHDAQEFLF
WLLDKVHEDLNTASKRRYKSIKNSYGRSDEIIAAETLANHIRCNNSFVQAVFQAQFRSSL
TCPRCKKQSNTFDPFHCISVQLPQLTQQTIFVTVVYMKQQPRQIKMGLRVPAGSPIVALR
EQLQTDTGIAGSRMVLVDLNAEGFTRVFYDTQPVETLSSIESIYCIEVPEAQAKIGATPK
AAPSPSAPEAAEKIASAPAPAAAPQADLLLLVANVYRAKDGKDMTRFGAPFSMKAPRDCS
YQDLQKRMLREMSPLLKPEVFSYTTPLADMFRIRLQDPSADPDTYLEQVEHPLLTEMIDM
ALSVLASEAGPPHIKLLLEWNSPEDHFLARQQETDDEAVVEHESVARLSASKAKDTAALT
LEQCLEHYTKAETLSAEDAWRCPHCQQYLPVVKTLGLWSLPDILVVHFKRFRQHQSKGPQ
AAKLTTMVKFPLTAFDMSPHLAKGVHESATSSSLGTLDGGGRGSNLWKRARSGDSRSSTL
NSRCDPKDTRYDLYAVCYHQGDTLETGHYTAACKNPYDRQWYKFDDQRVSKVPEDDIEQD
IINNEAYMLFYQRRSVDAGECSGSSSNSGDHWVSRIAPAPASATSSSADSTSGKENDGAI
KAEAGSSEVAESGPAAEKAQSKPVNIPLVNEEEAVAPEEPKVAANELPALPLNIEELDFA
DADADVSLSEDAKNEGIEAPAEQSQTTAAAAAAAAPKAAAAIEEVTHIFAMDEEQKEEPV
ELTKVISRSEILPESLPTADVVRTNGHVSPSSSSASSESSLSSRSSPRSLTTSVAAASTL
QNKLNGHMNTACSSMFNGNANATHPQLSSSLQLTRQVLSNHNWHGSRSSVSAVENATHQQ
QKQQAAAAASLSLRHSFSTSSNYKLRECTETLSSLLRNSTNTCSKDTLLFIDQQSHHHTA
GLIEDDDDSYMGRSLWISPVTPHKLITVSPKN
NT seq 3879 nt NT seq  +upstreamnt  +downstreamnt
atgggcacaactaaagagcaacaaaatgaaggcgacgccgcagcagaggcggccgtgggc
gccacccacacaacaccaactcaacatcagaggaaggagacagaagaagaagaagagaag
acgcttcccacaccgccagtggtagcctcaaccatggccacaaatgccgccaaaaagata
cgccgagccttctccatgccacgcaatccgtttcgctggtcgcgtaaattcaagacagca
gccgcagcggcagcaatagcaagcgacgcagagtctggagccggcaaggataatgcaggg
gagcgtcgaggcagccatacggctatttcgtcctgcgtaagcggcggacggggacgcagc
ggcagcattatttctctgagcagctacgaggcggcgcctggagacgccgcagccaccacc
accaccaatacatatgccaatagtaacagcaaccacaccaataacagtaccagtaacagc
aataagcgggcacgtgttctgcgccgttcgtccttcaagaaatttctgaatcgcattgct
cagcatctgagcgcaacggtgaatgttggatcggaggagcagagctctgctgccgccagt
cgggtaaacttgatagacatcgttcccttctacaccggatgctggcggagaaaagaggcg
aataaacaccggcaaacgaatggattgggatcggcgagcagcggcggaggaggagatcga
gtgcctcccattgggggctatcagtggccgccggatcagacgcccggagtgatggggctg
aagaatcatggcaacacctgcttcatgaacgccgtgctgcagtgcctcagccacacggac
attctagccgagtatttcgttttggaccagtacaaggctgaccttaagcgccgcaacaag
atcaattcgcgaaagttcggcaccaagggagagctcaccgagcagctggccaatgtgctg
aaggccctatggacatgccgcaacgagagcgaccacagcacgggcttcaaggcggtggtg
gatcgttacgggacgcagtttcgcagctccacgcagcacgatgcacaggagttccttttc
tggctgctggacaaggtgcacgaggacctcaatacggccagtaagcgacgctacaaaagc
atcaagaactcctatggccggtcggatgagatcattgccgccgagacactggcgaatcac
atacggtgcaacaatagctttgtgcaggccgtgttccaggcccagttccgatcctcgctg
acgtgtccgcgctgcaagaagcagtcaaacaccttcgatcccttccattgcatttccgtg
cagctgccgcagctcacacagcagacgatcttcgttacggtggtgtacatgaagcagcag
ccgcgacagatcaaaatggggctgagagtgccggccggatcgccgattgtggccctgcgg
gagcagctgcagacggacacgggcattgcggggtcgcgcatggtgctggtggacctcaat
gccgagggattcacgcgcgtcttctacgacactcagcccgtggagacgctcagcagcatc
gagagcatctactgcatcgaggtgccggaagcccaggcaaagatcggcgccaccccaaag
gccgctccctccccatcggctcccgaagcggcagaaaagatcgcctctgccccagcacct
gcggccgccccacaggcagatctgctcctcctagtggccaacgtgtacagagcaaaggac
gggaaagacatgacccgcttcggagccccgtttagtatgaaagctccgcgcgactgctcc
taccaggatctacagaagcggatgctgcgcgagatgtcgccgctgctcaagccggaggtc
ttctcctacacaacgcccctggcggacatgttccgcatccggctgcaggatccctccgcc
gaccccgacacctacctggaacaggtggagcatccgctgctcaccgaaatgatcgacatg
gccctctcagtgctcgcctcggaggcggggccaccgcacatcaagctcctgctggaatgg
aactcgcccgaggatcactttctcgcccgccagcaggagaccgacgatgaggccgtcgtt
gagcacgagagcgtggcacggctaagcgccagcaaggccaaagataccgccgccctaacg
ctggaacagtgcctggagcactacaccaaggcggagacgctcagtgctgaggacgcctgg
cgctgcccccactgccagcagtatctgcccgtggtgaagaccctgggcctgtggtcactg
cccgacatcctggtggtccacttcaagcgcttccgccagcaccagtcgaagggtccgcaa
gcggcaaagctcaccacgatggtcaagtttccgctgaccgccttcgacatgtccccccac
cttgccaagggtgtccacgagagcgccaccagcagctctctgggaaccctagatggcggc
ggtcgcggctcaaatctgtggaagcgggcccggtccggcgactcgcgctcttccaccctc
aactctcgctgcgaccccaaggacacgcggtacgatctgtacgccgtttgctaccaccag
ggcgatactttggagacgggccactatacggcagcctgcaagaacccatacgaccggcag
tggtacaagtttgatgaccagcgcgtgagcaaggtgcccgaagatgatatcgaacaggac
atcatcaacaacgaggcgtatatgcttttctaccagcgacgcagcgtagatgccggagag
tgctccggctccagttctaactctggggatcactgggtctcccgcattgctccagcccca
gcttcggcaacctcttcatcggccgactcaacatctggcaaggagaacgacggagctatt
aaggcggaggcgggctccagcgaagtggccgaaagtggaccagccgcggagaaggcccag
tccaagcccgtgaatattccactcgtgaatgaagaagaagctgtggccccagaagaaccc
aaagtcgccgccaacgaactcccagccctcccactgaacattgaggagctggacttcgcc
gatgccgatgcggatgtcagtttgagtgaagatgccaaaaatgaggggatagaagctcca
gcagagcaaagccaaacaactgcagctgcagcagcagctgcagcacccaaagctgcagcg
gctattgaggaagtcacgcacatttttgccatggacgaggagcagaaagaagaacccgtg
gaattgacaaaggtcatcagcaggagcgaaatactacccgagagtctgcccaccgctgat
gtggttcggaccaatggccatgtgagcccctcctctagctcggcttcgtcggagagctcg
ctctcgtcgcgttcctcgccacgttcgcttaccacctccgtggcagcggcatccacgctg
caaaacaaactcaatggccacatgaataccgcatgctcgagcatgttcaatgggaatgcg
aatgccacacacccgcagctatcctctagcctgcagcttacgcggcaggtgctgagcaac
cacaactggcatggatcccggagcagtgtctcggctgtggagaatgccacacaccagcag
caaaagcagcaggcggcggcggcagctagcctcagtctgcggcactccttctccaccagc
tccaactacaagctgcgcgagtgcaccgagacgctgtcctcgctgctgcgcaattcaacc
aacacctgcagcaaggacacattgctgtttattgatcagcagagccatcaccacacagcg
ggcctcatcgaggacgacgatgattcgtatatgggacggtccttgtggatatccccagtg
acgccacacaaacttattactgtttcgcccaagaattaa

DBGET integrated database retrieval system