KEGG   Drosophila persimilis: Dper_GL16798Help
Entry
Dper_GL16798      CDS       T01063                                 

Definition
GL16798 gene product from transcript GL16798-RA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dpe  Drosophila persimilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dper_GL16798
Enzymes [BR:dpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dper_GL16798
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dper_GL16798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 745 aa AA seqDB search
MGDAMKLKVKDIETLFSTDGYLRPFEREIRRRVRITLEANSAAASPHLRVCQHQRYQSLG
TDPRPCCCLQCLTLMVKPVAVEEDVTSVLLNAYATLGAPSFMGHGVLQEWLDKINQGDGG
MDQFTQGYKYYGLHFQPDNSVIAREWAPGAKNVYLAGDFNNWHWESHPFKKLEFGKWELH
LPPNADGSPQIKHLSEIKIIIRNHSDHLLDRLSPWAKYVVQPPKEANQGVNYKQYVWQPP
ESERYQRQHSRPARPKSLRIYECHVGIASQEPRVGTYDEFADRIVPRIKRQGYNCIQVMA
IMEHAYYASFGYQVTSFYAASSRCGNPEQLKRMIDVAHSHGLYVLLDVVHSHASKNVQDG
LNQFDGTNSCFFHDGARGEHSLWDSRLFNYVEYEVLRFLLSNLRWWHDEYNFDGYPGFSG
DYNEYFGLNVDTDVLNYLGLANHMLHTLDPEVITIAEDVSGMPTLCRPVSEGGIGFDYRL
GMAIPDKWIELLKEQSDDQWSMGDVVHTLTNRRWMENTVAYAESHDQALVGDKTIAFWLM
DKEMYTHMSTQSDSSLIIDRGLALHKMIRLITHALGGEAYLNFMGNEFGHPEWLDFPRVG
NNDSYHYARRQWNLVDDNMLKYKYLNEFDRAMNEAEQRYGWLHSGPAYVSWKHEGDKIIA
FERAGLVFVFNFHIHQSFTGYRVGTNWAGTYQAVLSSDDPRFGGHNRIDGNVKHRSDPEG
YAGRSNFIEVYSPSRTAVVYARVSD
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacgccatgaaacttaaggttaaggacatcgagacactattctcaacggatggc
tacttgaggcctttcgagcgtgagatccgacgacgcgttcgcatcacgctagaggcgaac
tccgcagccgcttccccacaccttcgggtctgccagcatcagcggtaccagagtctcggt
actgaccctagaccctgctgctgcctccagtgtctgaccctcatggtcaaacctgtggca
gtcgaagaggacgtgaccagcgtcctcctcaatgcctatgccacactcggggcaccatcc
tttatgggacatggcgtactccaggagtggctggacaagatcaaccaaggcgatggcgga
atggaccagttcacgcagggatacaaatactacggcctgcactttcagccggacaactcg
gtgattgcccgggagtgggcaccgggggccaagaatgtctatctggcaggcgacttcaat
aactggcactgggagtcgcatcccttcaagaaacttgagtttggcaagtgggaactgcat
ctgccccccaatgcggatggcagtccacagatcaagcacctgagcgagattaagatcatc
attcggaaccattctgatcacttgctggatcgcctgtcgccctgggccaagtatgtggtg
cagccaccaaaggaggccaaccaaggggttaactacaagcagtacgtgtggcagccacca
gaatcggagcgctaccagcgccagcattcccgtccagccaggcccaagtccttaaggatt
tacgagtgccatgtgggcattgcctcgcaggagccgcgcgtgggcacctacgacgagttc
gccgatcgcattgtgccccgcatcaagcggcaggggtacaactgcatccaggtgatggcc
atcatggagcacgcctactatgccagctttggctaccaggtgaccagcttctatgccgcc
tccagccgctgcggcaacccagaacagttgaagcgaatgattgatgttgcccattcccac
gggctgtacgtcctgttggatgtcgtccactcgcatgcctcgaagaatgtacaggatggc
ttgaaccagtttgacggcaccaatagctgcttcttccacgacggagcccgcggcgagcac
tctctgtgggacagtcgtctgttcaactatgtggagtacgaggtgctgcgcttcttgctg
tccaacctgcgctggtggcacgacgagtacaactttgatggctaccctggcttcagcggc
gactacaatgagtactttggcctgaatgtcgacacggatgttctcaactatctggggctg
gccaatcatatgctgcacacgctggaccccgaagtcatcaccattgcggaggatgtctcg
ggaatgccgacgctgtgccgtcccgtctcggagggcggcattggcttcgattatcgcctg
ggcatggctataccggacaagtggattgagctgctcaaggagcagagcgacgaccaatgg
agcatgggggacgtagtccacaccctaaccaatcgccgctggatggaaaatacggtggcg
tacgcagagtcgcacgatcaggccctggtcggggacaagaccattgccttctggctgatg
gacaaggagatgtacacgcacatgtcgacgcagtcggactccagcttgattatcgatcgt
ggcctggcactgcacaagatgatacgcctgatcacacatgccctcggcggagaggcctat
ctgaacttcatgggcaatgagtttggacatcccgagtggctggacttcccccgcgtgggc
aacaacgactcgtaccactatgcccgtcggcagtggaacctggtggacgacaacatgctg
aagtacaaatacctcaatgagttcgatcgggccatgaacgaggctgagcagcgctacggt
tggctgcattccggacccgcctacgtcagctggaagcacgagggcgacaagatcatcgcc
tttgagcgtgccggactggtcttcgtctttaacttccatatacaccagagctttactggc
taccgcgtgggcaccaactgggcgggcacctatcaggcggtgctctcctcagacgatcct
aggtttggcggccacaaccgcatcgatggcaatgttaagcatcgctccgacccggaggga
tacgctggtcgttccaacttcattgaggtctacagcccatcacgtacggccgtagtctat
gcccgcgtcagcgattaa

DBGET integrated database retrieval system