KEGG   Drosophila persimilis: Dper_GL17007Help
Entry
Dper_GL17007      CDS       T01063                                 

Definition
GL17007 gene product from transcript GL17007-RA
Orthology
K12625  
U6 snRNA-associated Sm-like protein LSm6
Organism
dpe  Drosophila persimilis
Pathway
RNA degradation
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Lsm 2-8 complex
Lsm 1-7 complex
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    Dper_GL17007
  Folding, sorting and degradation
   03018 RNA degradation
    Dper_GL17007
Messenger RNA biogenesis [BR:dpe03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     Dper_GL17007
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     Dper_GL17007
Spliceosome [BR:dpe03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    Dper_GL17007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 79 aa AA seqDB search
MSRKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYG
DAFIRGNNVLYISTQKRRV
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcaaagaagccctctcgcagtttatcaaccagatccatggtcgccccgtggcc
gtgaagctgaacaacggcgtggactatcgcggtgtgctggcttgcttggatggctatatg
aacatttgcctggagcagacggaggagtacgtaaatgggcagctgaaaaacaaatacggc
gacgcattcatccgcggaaacaacgtgctctacatatccacgcagaaacggagagtttag

DBGET integrated database retrieval system