KEGG   Drosophila persimilis: Dper_GL17007Help
Entry
Dper_GL17007      CDS       T01063                                 

Definition
GL17007 gene product from transcript GL17007-RA
Orthology
K12625  
U6 snRNA-associated Sm-like protein LSm6
Organism
dpe  Drosophila persimilis
Pathway
RNA degradation
Spliceosome
Module
Lsm 2-8 complex
Lsm 1-7 complex
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:dpe03040]
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:dpe03018]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 79 aa AA seqDB search
MSRKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYG
DAFIRGNNVLYISTQKRRV
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcaaagaagccctctcgcagtttatcaaccagatccatggtcgccccgtggcc
gtgaagctgaacaacggcgtggactatcgcggtgtgctggcttgcttggatggctatatg
aacatttgcctggagcagacggaggagtacgtaaatgggcagctgaaaaacaaatacggc
gacgcattcatccgcggaaacaacgtgctctacatatccacgcagaaacggagagtttag

DBGET integrated database retrieval system