KEGG   Drosophila persimilis: Dper_GL17166Help
Entry
Dper_GL17166      CDS       T01063                                 

Gene name
Dper_ST6Gal
Definition
Sialyltransferase
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
dpe  Drosophila persimilis
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:dpe00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:dpe00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 452 aa AA seqDB search
MWQVKRALSGQCQTLLGVLLLSAALIIHSAQIGGAAKAQPRLEPGVGEVNSAEAVNENGR
GNVSRRLPRSVFHVRWNPNEKFVVESRESPAINSSKLAPHPRLKVSKNTKLTLSPKLYLC
HDKYSELCHNKTQQFRQRIVQTFEKSMSESFNDSQPNPYHVDYKPVFGDSFEEQYYPSTC
LVMEAGVRVLRRKDKPFDKVPFGRLFPRQKLFRNIKNIKTCAIVSSAGSLAGSKLGRFID
THDIVMRFNHAPTQGHEVDVGSKTTIRVVNSQVVTKPEFDFAHAPIFRNVTIAAWDPGKY
NGTLEDWLTSADYDLFSNYEIYRRRYPKSRAFLIDPHSVWRLWQTLQMFAGNRSIRRNPP
SSGFIGLALLLPHCPQVDFVEYIPSTRLNGRCHYYSKEMNAACTFGSWHPLAAEKLMTLD
MNTADDMSVFQFGILRIRRPDKLLCGFNFFGY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaagtgaaacgcgcattgtcgggtcagtgtcagaccctactcggtgtcctcctt
ctgagcgccgcgttaataattcacagcgcacaaatcggaggagccgcgaaagctcagccg
agactcgaacccggcgtgggtgaggtgaatagcgccgaggcggtcaacgaaaatggacgt
ggaaatgtgtcgaggcgactgccgcggagtgtgttccatgtgcgatggaatcccaacgaa
aagttcgttgtggagagtcgcgagagtccggccatcaactcctccaagctggcgccacat
ccgcggctgaaggtctccaagaacacgaagctgacgctcagccccaagctgtacctgtgc
cacgacaagtactcggagctgtgccacaacaagacgcagcagttccggcagcgcatcgtc
cagaccttcgagaagtccatgagcgagtccttcaacgactcccagcccaatccctaccac
gtcgactacaagcccgtgttcggggacagcttcgaggagcagtactatccctccacctgc
ctggtcatggaggcgggcgtgcgggtactccgccgtaaagacaaacccttcgataaggtt
cccttcggccgcctctttccgcgccagaagctctttcgcaacatcaagaacatcaagacg
tgtgcgattgtctccagcgcgggctccctggccggctccaagctgggtcgcttcatcgac
acgcacgacattgtgatgcgattcaatcatgcgcctacgcaaggacacgaggtggatgtt
ggcagcaaaaccacaattcgtgtggtgaattctcaagtggtcaccaagcccgagtttgac
ttcgcccacgctcccatctttcgcaatgtgacgatcgccgcctgggatccaggcaagtac
aacgggacgttggaggactggctcaccagcgcggactatgacctgttcagcaactacgag
atctataggcgtcgctatcccaagtcgcgggccttccttattgatccccattccgtgtgg
cgactgtggcagacactgcagatgtttgccggaaaccgttctattaggcgtaatccaccc
agctcgggtttcatcggtctggccctgctcttgccccattgtcctcaggtggactttgtg
gagtatattccctccacgcggctcaatggacgctgtcactactacagcaaggagatgaat
gccgcctgtacattcggctcttggcatcccctggccgccgagaagctgatgacattggac
atgaatacggcggatgacatgtctgtcttccagtttggcatattgcgtatacgcaggccg
gacaaactgctctgcggcttcaacttctttggctattga

DBGET integrated database retrieval system