KEGG   Drosophila persimilis: Dper_GL17170Help
Entry
Dper_GL17170      CDS       T01063                                 

Definition
GL17170 gene product from transcript GL17170-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dpe  Drosophila persimilis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dper_GL17170
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dper_GL17170
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dper_GL17170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 520 aa AA seqDB search
MDKRLILLLVGVAVWLSGNASGQRDHPRKWGSGEPHPIKYVEEQKTAYWVEKAQETLHAK
LAETQAAHTNAAKNVIMFLGDGMSVHTVTATRNLLGDSAEKVYFEQFPYTGLSKTYCVNR
QVADSACTATAYLGGVKGNYGTIGINANVARYSCDGAAMEENQVESIAQWAQEAGKDAGL
VTTARVTHASPAGVYAHIADRNWENDWEVTNRQCNTEQTPDIARQLVEGQVGKALKVILG
GGRQQFINTTVNDEEGYPGYRTDGRHLIKDWLADKQAANASANYVWSRKGLSLVDLDKTE
YLLGLFATSHLPYDGDRARNRSQLADPSLTELTEAAIRVLQRNEKGFFLFVEGARIDMAH
HDTYARRSLEDTAEFARAVQKAREMTSDEDTLIVVTADHAHTMSINGYPYRDQEIFGLTD
DDTDDDLPYAILSYANGPGYKSAFNLADGRARLTEKLTDKTDFQFPSMVPLDAESHGGDD
VAVYASGPFSQFFSGNYEQTNIPAMMARAAGIGPYGNIQP
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacgattgattctactgcttgtcggtgtcgctgtctggctgagcggaaatgcc
agtggccagagagatcatccacgaaaatggggcagcggtgagccgcatcccatcaaatat
gtggaggagcagaagaccgcgtactgggtggagaaggcccaggaaaccctgcacgccaag
ctggccgagacgcaggcggcccacacaaacgcggccaagaatgtgatcatgttcctgggc
gacggcatgtccgtgcacactgtgaccgccacaaggaacctgctcggcgacagtgccgaa
aaggtctacttcgagcagttcccctacacgggcctgtccaagacgtactgcgtcaaccgt
caggtggcggattcggcctgcactgccaccgcctatctgggcggggtcaagggcaactac
ggcaccatcggcatcaatgcgaacgtagcgcgctacagctgcgacggcgccgccatggag
gagaaccaggtggagagcatcgcccagtgggcgcaggaggcgggaaaggatgcgggcctc
gtgaccacggccagggtgacacacgcttctccagcgggcgtctatgcccacatcgctgac
cgcaattgggagaacgactgggaggtgacgaacaggcagtgcaacaccgagcagaccccg
gacatagctcgtcaactggtggaggggcaggtgggcaaggcactgaaggtgatcctcggc
ggcggacgccagcagttcatcaacaccacggtgaacgacgaggaaggctatcccggctac
cgtaccgacggacggcacctcatcaaggactggctggcggacaagcaggcggccaatgcc
tcggccaactatgtctggagtcggaagggtctcagcctcgtggatctcgacaagaccgag
tatctgctgggtctctttgccacctctcatctgccctatgacggcgaccgggcacgcaat
cgcagtcagctggcggatccatcgctgaccgagctgacggaggcggccatccgggtgctg
cagcgcaacgagaagggattctttctgttcgtcgagggagcccgcatcgacatggcccac
cacgacacctatgccaggcggtccctcgaggacacggccgagttcgcgcgagctgtgcag
aaggcgcgtgagatgacctccgacgaggatactctaatcgtggtcaccgcggatcacgca
cataccatgtccatcaacgggtatccgtatcgcgaccaggagatcttcggcctgaccgat
gacgataccgacgatgatctgccctatgcgatcctttcctatgccaatggtcccggctac
aagagcgccttcaatctggctgacggcagggctcgcctcaccgagaagctcacggacaaa
acggacttccagtttcccagcatggtgcctctcgatgctgagtcacacggtggcgacgac
gtggcagtctatgcctctggtcctttttcccagttctttagcggcaactacgagcagacc
aatattcccgctatgatggcccgggccgcaggcattggaccgtatggcaatatccagcca
tag

DBGET integrated database retrieval system