KEGG   Drosophila persimilis: Dper_GL17350Help
Entry
Dper_GL17350      CDS       T01063                                 

Definition
GL17350 gene product from transcript GL17350-RA
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dper_GL17350
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dper_GL17350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 730 aa AA seqDB search
MAVKQNNSEPNEATDGVNSASGGASNGAMPANGKQPAANNIKISDDGGGAAGAESMDTNG
TSPSETSEDAGQLNTLFSTPLISEAVQSLLDTNVHDSSIRKTVVLLCEWICVCNFCPNLN
MWVMALLTGLRNQGKHVLLDDISLDAIEKLFKALILPAMRPKAAPIVFHMLSTINQTPEI
FRKILPRVPQVLNFLKQQSNSTDEFGAETRQCMQQLVDLTSALMLRFNENSDLYASVRIA
MQMYEPSPNCGAMARAMQENAMPAGRRNARVGLVNLGNTCYMNSVLQALAMTSDFSRQIL
LVQSDSLLLLKVQQQIALMHHSMRCELTPTRVLNAARPPGFTQGLQQDSSEFLGYLLDLL
HEQEINKVGSHSLHGNDVDAPGELNDEILSSGVIPYNSHDREIAGSSTSASHKPTSTPTK
GTNSSQQQQPKKPKSTIDKTFTGKLSTTYNCSDCSWESHNEDSFRELQLSFPDDKDDCSA
TNYSVQDLIEYYCSPEKLDGENQYFCPRCEKLCDADRRIGVTEAPRNLVLTLKQFKYDQK
YHFRTKLMHKVFHDESLVVKICSTDSLQEQSAVYYEMYAGVVHSGYHMDSGHYFTFAADQ
SRNWYKFNDSIVTSSQSEELHNLTSPNTPYILFYKMCGRSHESEMVSVPQVPPLTLEELP
SPLRDYVKKDNRAYSEEVRSQRFQGSNGTNGHGFLTRNDYDGDDEDDRAPPPSGGCGGND
LGMNVNRFVY
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaagcagaacaacagcgagcccaacgaagccaccgatggggtcaactctgcc
tccggcggtgcctcaaacggcgccatgccagccaatggtaagcaaccagcagccaacaac
ataaagatctccgacgatggtggcggcgccgccggcgccgagagcatggacacgaatggc
accagccccagcgagacaagcgaggatgccggccaactgaacacactgttcagtactccg
ctcatcagtgaggctgtgcaatcgctgctggacacgaatgtccacgactcgagcatacgc
aagacggtggtcctgctgtgcgaatggatctgtgtgtgcaacttctgcccgaacctcaat
atgtgggtcatggccctgttgacaggccttcgcaatcagggcaagcatgtgctcctcgac
gacatttccctggacgccatcgaaaagctcttcaaagcgctaatactacccgccatgcgc
cccaaggcggctccgatagtgttccacatgctgtcgaccatcaatcagacacccgaaata
ttccgcaagatattgccacgtgtaccccaggtgctgaactttctgaagcagcagtccaac
agcacggacgaattcggagcggagactcgccagtgcatgcagcagctggtcgatctaacc
agtgccctgatgctgcgtttcaacgaaaacagcgatctctatgcatccgtgaggattgcc
atgcagatgtatgagccgtcgccaaactgcggggctatggcccgggccatgcaggagaac
gccatgcccgcgggacgacgcaatgcaagggtgggactggtgaatctcggcaacacgtgc
tacatgaacagcgtactccaggccctggccatgaccagcgatttcagccgccagatactg
ctggtccagagcgattctttgctgctgctgaaggtgcagcaacagattgcccttatgcac
cactcgatgcggtgtgagctgacaccaacgcgcgtgttgaacgccgcaaggccgccgggc
ttcacacagggtctgcagcaggacagctccgagttcctaggctatttgctcgacctgctg
cacgaacaggagatcaacaaagttggaagccacagtctgcatggcaatgacgtcgatgcc
ccgggcgagctaaacgatgagattctgtccagcggagtcataccctacaacagccatgac
cgcgagatcgccggcagcagcaccagtgccagtcacaagcccacttcgacacccaccaaa
ggcacaaatagctcacagcaacagcagccaaagaagccaaaatcaaccattgacaagacg
ttcaccggcaaactgtcgacgacgtacaattgttcggactgcagctgggagagccacaac
gaggacagcttccgtgagctgcagctatcgtttccggacgacaaggacgactgcagtgcc
accaattattcggtgcaggacctgatcgagtactactgctcgccggagaagctggacggg
gagaatcagtacttctgtccccgctgcgagaagctctgcgatgccgatcgccgtatcggg
gtgacagaggcgccacgcaatctcgtcctgactctcaagcagttcaagtacgatcagaag
taccattttcgcaccaagctaatgcacaaggtgtttcacgatgagagtctcgtggttaag
atatgctcaaccgattcactgcaggagcagtcagcagtttactatgagatgtacgcaggc
gtggtacattcgggctaccacatggactccggccattacttcaccttcgccgctgaccag
tccaggaactggtacaagttcaacgacagcattgtgacctcttcgcagtccgaggaattg
cacaacctcacctcgcccaacaccccctacatactcttctacaagatgtgcggccgctcg
cacgagtccgagatggtgtcggtgccccaagtcccaccgctcactctggaggagctgccg
agcccactgcgcgactatgtgaagaaggacaatcgggcgtacagcgaggaagtgcgctca
cagcgcttccagggcagcaacggaaccaacgggcatggattccttacgcgcaacgactat
gacggcgacgatgaggatgatcgtgccccaccgccctcaggcggctgtggtggcaacgac
ctgggcatgaatgtgaatcgcttcgtctactga

DBGET integrated database retrieval system