KEGG   Drosophila persimilis: Dper_GL17350Help
Entry
Dper_GL17350      CDS       T01063                                 

Definition
(RefSeq) GL17350 gene product from transcript GL17350-RA
  KO
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dper_GL17350
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dper_GL17350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 730 aa AA seqDB search
MAVKQNNSEPNEATDGVNSASGGASNGAMPANGKQPAANNIKISDDGGGAAGAESMDTNG
TSPSETSEDAGQLNTLFSTPLISEAVQSLLDTNVHDSSIRKTVVLLCEWICVCNFCPNLN
MWVMALLTGLRNQGKHVLLDDISLDAIEKLFKALILPAMRPKAAPIVFHMLSTINQTPEI
FRKILPRVPQVLNFLKQQSNSTDEFGAETRQCMQQLVDLTSALMLRFNENSDLYASVRIA
MQMYEPSPNCGAMARAMQENAMPAGRRNARVGLVNLGNTCYMNSVLQALAMTSDFSRQIL
LVQSDSLLLLKVQQQIALMHHSMRCELTPTRVLNAARPPGFTQGLQQDSSEFLGYLLDLL
HEQEINKVGSHSLHGNDVDAPGELNDEILSSGVIPYNSHDREIAGSSTSASHKPTSTPTK
GTNSSQQQQPKKPKSTIDKTFTGKLSTTYNCSDCSWESHNEDSFRELQLSFPDDKDDCSA
TNYSVQDLIEYYCSPEKLDGENQYFCPRCEKLCDADRRIGVTEAPRNLVLTLKQFKYDQK
YHFRTKLMHKVFHDESLVVKICSTDSLQEQSAVYYEMYAGVVHSGYHMDSGHYFTFAADQ
SRNWYKFNDSIVTSSQSEELHNLTSPNTPYILFYKMCGRSHESEMVSVPQVPPLTLEELP
SPLRDYVKKDNRAYSEEVRSQRFQGSNGTNGHGFLTRNDYDGDDEDDRAPPPSGGCGGND
LGMNVNRFVY
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaagcagaacaacagcgagcccaacgaagccaccgatggggtcaactctgcc
tccggcggtgcctcaaacggcgccatgccagccaatggtaagcaaccagcagccaacaac
ataaagatctccgacgatggtggcggcgccgccggcgccgagagcatggacacgaatggc
accagccccagcgagacaagcgaggatgccggccaactgaacacactgttcagtactccg
ctcatcagtgaggctgtgcaatcgctgctggacacgaatgtccacgactcgagcatacgc
aagacggtggtcctgctgtgcgaatggatctgtgtgtgcaacttctgcccgaacctcaat
atgtgggtcatggccctgttgacaggccttcgcaatcagggcaagcatgtgctcctcgac
gacatttccctggacgccatcgaaaagctcttcaaagcgctaatactacccgccatgcgc
cccaaggcggctccgatagtgttccacatgctgtcgaccatcaatcagacacccgaaata
ttccgcaagatattgccacgtgtaccccaggtgctgaactttctgaagcagcagtccaac
agcacggacgaattcggagcggagactcgccagtgcatgcagcagctggtcgatctaacc
agtgccctgatgctgcgtttcaacgaaaacagcgatctctatgcatccgtgaggattgcc
atgcagatgtatgagccgtcgccaaactgcggggctatggcccgggccatgcaggagaac
gccatgcccgcgggacgacgcaatgcaagggtgggactggtgaatctcggcaacacgtgc
tacatgaacagcgtactccaggccctggccatgaccagcgatttcagccgccagatactg
ctggtccagagcgattctttgctgctgctgaaggtgcagcaacagattgcccttatgcac
cactcgatgcggtgtgagctgacaccaacgcgcgtgttgaacgccgcaaggccgccgggc
ttcacacagggtctgcagcaggacagctccgagttcctaggctatttgctcgacctgctg
cacgaacaggagatcaacaaagttggaagccacagtctgcatggcaatgacgtcgatgcc
ccgggcgagctaaacgatgagattctgtccagcggagtcataccctacaacagccatgac
cgcgagatcgccggcagcagcaccagtgccagtcacaagcccacttcgacacccaccaaa
ggcacaaatagctcacagcaacagcagccaaagaagccaaaatcaaccattgacaagacg
ttcaccggcaaactgtcgacgacgtacaattgttcggactgcagctgggagagccacaac
gaggacagcttccgtgagctgcagctatcgtttccggacgacaaggacgactgcagtgcc
accaattattcggtgcaggacctgatcgagtactactgctcgccggagaagctggacggg
gagaatcagtacttctgtccccgctgcgagaagctctgcgatgccgatcgccgtatcggg
gtgacagaggcgccacgcaatctcgtcctgactctcaagcagttcaagtacgatcagaag
taccattttcgcaccaagctaatgcacaaggtgtttcacgatgagagtctcgtggttaag
atatgctcaaccgattcactgcaggagcagtcagcagtttactatgagatgtacgcaggc
gtggtacattcgggctaccacatggactccggccattacttcaccttcgccgctgaccag
tccaggaactggtacaagttcaacgacagcattgtgacctcttcgcagtccgaggaattg
cacaacctcacctcgcccaacaccccctacatactcttctacaagatgtgcggccgctcg
cacgagtccgagatggtgtcggtgccccaagtcccaccgctcactctggaggagctgccg
agcccactgcgcgactatgtgaagaaggacaatcgggcgtacagcgaggaagtgcgctca
cagcgcttccagggcagcaacggaaccaacgggcatggattccttacgcgcaacgactat
gacggcgacgatgaggatgatcgtgccccaccgccctcaggcggctgtggtggcaacgac
ctgggcatgaatgtgaatcgcttcgtctactga

DBGET integrated database retrieval system