KEGG   Drosophila persimilis: Dper_GL17352Help
Entry
Dper_GL17352      CDS       T01063                                 

Definition
GL17352 gene product from transcript GL17352-RA
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Dper_GL17352
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   Dper_GL17352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 423 aa AA seqDB search
MRLFPVRLSAASSSMASLTKMLDFYSGFNPSPLSIKQFMDFGQNACEKKSYIFLRKELPV
RLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEEVLEYEKADPTHDNLHKFVHHLDLIR
NRHNDVVQTMAQGVIEMKENEGGTVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLFGA
NPHSGGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLTSPALEIQEYCREPEGNLPIRT
VYVPSHLYYMLFELFKNSMRAVVEHHNNDNCDTLPPLKVAICRGQEDICVKISDQGGGIP
RSQTDQLFKYMYSTAPQPSKSDLHTVPLAGYGYGLPISRLYARYFHGDIVLLSCEGFGTD
AIIYLKALSDEANELLPIFNKTSSKFYRATVPTGDWSNQSSDMNARQLSATTPKRYNDLV
QDA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgttcccggtacgcctctcggccgcctcgtcctcgatggcgagcctgaccaaa
atgctcgacttctactcgggcttcaacccatcgccgctatccatcaaacagtttatggac
tttgggcaaaatgcgtgcgagaaaaagtcgtacatatttctgcgaaaggagctgccggtg
cgattggccaacatcatgaaggagattgccctgctgccggacaatctgctgcacaccaga
tccgtcagcgaggtgagctcctggtacgtgaagagcttcgaggaggtgctggagtacgag
aaggccgatcccacacacgacaatttgcacaagtttgtgcatcatctggatctcattagg
aatcggcacaacgatgtggtgcagacgatggcacagggcgtcattgaaatgaaggagaac
gagggcggcacggtagatgcgcccaccgagagctctatacagtactttctcgatcggctg
tacatgtcgcgcatcagcatccggatgctgatcaatcagcacactctgctctttggagcg
aatccccactcgggtggtcggcacatcggctgcctggacccagcctgtgacttgtcggac
gtggtgcgcgatgcgtatgagaacgcccgcttcctctgtgatcaatattatctgacgagc
cccgcgctggaaatccaggagtattgccgtgagccagagggcaacctgcccatccgcact
gtctacgtgccctcgcatttgtattacatgctcttcgagctcttcaagaactccatgaga
gctgtggtggagcaccacaataatgacaactgcgacaccctgccgcccctcaaggttgcc
atctgccgcggccaggaagacatctgcgtgaagatctccgatcagggtggcggcattccg
cgctcccaaactgaccagcttttcaagtacatgtacagcacggctccgcagccatccaag
tcggatctgcacacggttcctttggccggctatgggtacggtctgcctatatcgcggctc
tacgctcgctacttccatggcgacatagtgctgctctcgtgcgagggcttcggcacggat
gccataatctacctaaaggctctgtccgatgaggccaacgagctgctgcccatcttcaac
aagacgagctccaagttctatcgcgccacggtgcctacgggcgactggtccaatcagagc
tccgatatgaatgcccgacagctgtcggccaccacaccaaaacgctacaacgacttggtc
caggatgcctaa

DBGET integrated database retrieval system