KEGG   Drosophila persimilis: Dper_GL17610Help
Entry
Dper_GL17610      CDS       T01063                                 

Definition
GL17610 gene product from transcript GL17610-RA
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dpe  Drosophila persimilis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dper_GL17610
   01230 Biosynthesis of amino acids
    Dper_GL17610
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dper_GL17610
   00030 Pentose phosphate pathway
    Dper_GL17610
   00051 Fructose and mannose metabolism
    Dper_GL17610
   00052 Galactose metabolism
    Dper_GL17610
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dper_GL17610
Protein phosphatases and associated proteins [BR:dpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dper_GL17610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 788 aa AA seqDB search
MNSEINQRFLARGSQKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKAYFIREGYQGM
VDGGDNIQEANWASVSSIIHRGGTIIGSARCADFRERAGRLKAANNLVQKGITNLVIIGG
DGSLTGANLFRQEWSSLLDELVKNGSITAAQQEKNSVLHIVGLVGSIDNDFCGTDMTIGT
DSALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLALVAGLSSEADFIFIPEMPPKVD
WPDRLCTQLAQERSAGQRLNIVIVAEGAMDREGNPITAEDVKKVIDERLKHDARITVLGH
VQRGGNPSAFDRILACRMGAEATLALMEATKDSVPVVISLDGNQAVRVPLMECVERTQAV
AKAMKEKRWADAVKLRGRSFERNLETYKMLTRLKPPKECFDAAGKGIEGYRLAVMHIGAP
SCGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKR
TLPEGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVVPATISN
NVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGAD
AAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKACENYSTDFIYRLYSEEGKGL
FTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLAEQIKANINANGEITCKAPDTATL
LGIVSRQYRFTPLVDLIGETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE
ECATDAVA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgaactccgaaattaatcaacgttttctggcccgcggctcgcagaaggacaaggggctg
gcagtcttcaccagcgggggggactcccagggcatgaatgccgctgtgcgtgcatgtgtg
cgtatggccatatatttgggatgcaaggcctacttcatccgcgaaggctaccagggcatg
gtagatggcggtgacaatattcaggaggccaactgggcctcggtgtcctccatcatccat
cgcggcggcactattattggctccgcccgctgtgcggatttccgtgaacgcgcaggccgc
ctcaaggccgccaacaacctggtgcagaagggaatcaccaacctggtgataattggcggt
gatggctcccttaccggcgccaatctgttccgtcaggagtggtccagcctgttggatgag
ctggtgaagaatggcagcatcactgccgcccagcaggagaagaacagtgtgttgcacatc
gtgggattggtcggctctattgataacgatttctgtggcacggacatgaccattggtacg
gactctgcactgcatcgcatcatcgaggctattgacgccatttcaagcacggcctactca
catcaacgcaccttcattatggaggttatgggtcgtcattgcggttatttagcacttgtt
gccggattgtctagtgaagctgatttcatattcattccggaaatgcccccgaaagtcgat
tggccagataggctgtgcactcaattggcccaggaacgatcggctggccagcgtttgaac
attgtcatcgtggctgagggtgctatggaccgtgagggaaatccaattaccgctgaggat
gttaagaaggtgatcgatgaacgcttgaagcacgatgcacgcatcacggtcctcggtcat
gtccagcgcggcggcaatcccagcgccttcgatcgtattttggcatgccgcatgggcgcc
gaggcgactttggctctgatggaggccactaaggattctgtgcctgtggtcatctctttg
gatggcaatcaggccgtgcgtgtgccgttgatggagtgtgtggagcgcactcaggcagtg
gccaaggccatgaaggagaaacgctgggcggatgccgtcaagctgcgtgggcgctccttc
gagcgcaatctggagacatacaagatgttgacccgcttgaagccaccaaaggagtgcttc
gatgccgcaggcaagggcatcgaggggtacaggctagcagtcatgcacattggtgccccc
tcttgtggcatgaacgcggccgtgcgcagtttcgtgcgcaatgccatctatcgtggcgac
gttgtctatggcatcaacgacggtgtcgagggtctcattgctggcaatgtacgtgaattg
ggatggtcggatgtgagtggatgggtgggacagggcggcgcctatctgggcaccaaacgc
accctgcccgagggaaagttcaaagagattgctgctcgtttgaaggaattcaagatccag
ggtctcctcatcatcggtggattcgagagttaccatgccgccggacagatcgccgatcag
cgcgataactatccacagttctgcatcccgatcgtggtcgtacccgcgacgatttcaaac
aatgtgcccggcacagagttctcgctcggctgcgacacgggtctgaatgaaatcacggag
atttgcgaccgtatccgccagtcggcccagggcacgaagcgtcgtgtgttcgttatcgag
acaatgggcggatattgcggctatttggctacgctggctggtctggccggtggtgcggat
gccgcgtacatttacgaggagaagttctccatcaaggacctgcagcaggatgtctaccac
atggccagcaaaatggccgagggcgtttctcgaggtctgatcctgcgcaacgagaaggct
tgcgagaactatagcacagacttcatctatcgcctgtactcggaggaaggcaagggtctc
ttcacctgccgtatgaacatcctcggccacatgcagcagggaggatcgcccacacccttc
gaccgcaacatgggcacgaagatggcggccaagtgcgtcgactggttggctgagcagatc
aaggcgaacatcaatgccaacggcgagatcacctgcaaggctcctgacaccgccactttg
ctgggcattgtgtcgcgtcaataccgcttcactccactcgtcgatctcattggggagaca
aactttgatcaacgcataccaaagaagcaatggtggctgcgtctgcgtccgcttctgaga
atccttgccaagcacgactctgcctacgaggaggagggtatgtacatcaccgtcgaggag
gaatgcgccaccgatgccgttgcctag

DBGET integrated database retrieval system