KEGG   Drosophila persimilis: Dper_GL17825Help
Entry
Dper_GL17825      CDS       T01063                                 

Definition
GL17825 gene product from transcript GL17825-RA
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dpe  Drosophila persimilis
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    Dper_GL17825
Enzymes [BR:dpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dper_GL17825
Transcription factors [BR:dpe03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    Dper_GL17825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1039 aa AA seqDB search
MDDESDDKDDTKRKSRNLSEKKRRDQFNSLVCDLSTLISTSGRKMDKSTVLKSTISFLRN
HNEAADRSKVFEIQQDWKPTFLSNDEFTHLMLESLDGFMIVFSSLGAIFYASESITSQLG
YLPQDLYRMNIYDLAYEMDHEALMNVFVNPPPVIEPRQTEISASNEISFYSHIRRGGVEK
ADTNSYELVKFVGYFRNDPNTSAGSRSASPSGSQSAPVLPRIFRENTSVEVDRKLVFVGT
GRVQNPQLIREMSIIDPTSNEFTSKHSMEWKFLFLDHRAPPIIGYMPFEVLGTSGYDYYH
VDDLDNIVACHEELRQTGEGKSCYYRFLTKGQQWIWLQTDYFVSYHQFNTKPDYVVCTHN
VVSYAEVIKHTQKERQQASSKDCKAQTSTASSSKPATATTTLRDLELANENLESNLLDNS
LSKLTNETTATSPAVESSPMWSATVTVAAAAASGSCQANPLKIARPASSYSNISSTGISP
KAKRKCYFYNNRGNDSDSTSMSTESGTSRQSGASRHSVLTHASSQSQRQRSQLRDHSQSH
NNNHHQQQQQQQQHQQQQAQQQQQQQQHLQHLQQQQQQIQQQLQQNVGPPKLVPMLPIGP
AQIMAGNAFPQSPYPLASPQLVAPTFLEPQQFLAAIPMQPVIGPFPVPPVPVLSPLAVPS
QGQGQQELLPGSVVMTPTQSQLQDQLQRKHDELQKLIMQQQDELRIVSEQLLLARYTYFQ
PVVQMGLSPGNIAPGNMTPGSMTPGAAMPNAAGGSVQQRAFNFSSTNAVQPHFNQYGFAL
NSEQMQNQQDQQMMMQQQQNLHSQQQHNLHQQHQNQNQMQQQQHLLEQQQLQLQQQQQNE
MLSREDIEDIDAFLNLSPLQSLEPPAALNPSHNNNHSSFNNGNGNSSQNIIGHNNSNNNN
NNSNSNNNNNNSSSTAPQNHNEDSLLSYMQMATSPSVNFHMGISDDSETQSEDKMRMGSS
SSHLQLQQQHLLQQQQQQQQQQHQQLPESSSFYHSNPFVAHLQNQNQLPNDLEILPFQMS
QEQSQNLFDASNTAPGGSQ
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgagagcgacgacaaggatgatacgaaaagaaagtcacggaatctgagcgag
aaaaagcgacgggatcagttcaactctttggtctgcgatctgagcaccctgatatccacc
tccggtcggaagatggacaagtcgacggtcctcaagtcaaccatttcattcctgaggaat
cataatgaggccgcggaccgatccaaggtttttgagatacaacaagactggaagcccacg
tttctgagcaacgacgagttcacgcacctgatgctggagtccctcgatggtttcatgata
gtctttagcagcttgggtgctatattctatgcctcggaaagtattacctcacagctgggc
tatttgccgcaagacctgtacagaatgaacatctacgatctggcctatgaaatggaccac
gaggccctcatgaacgtcttcgtcaatccgccgcctgtgatcgagccccggcagacggaa
atcagtgccagcaacgagatatccttctacagccatataaggcgcggcggggtcgagaag
gcggataccaactcctacgaactggttaaatttgtgggttactttcgtaacgatcccaac
acctcggcgggctcccgttccgcaagtccgagcggcagccagtctgcgcccgtcctgccg
cgcatcttccgtgagaacaccagcgtggaggtggacagaaagctggtatttgtgggcacg
ggccgcgtccagaacccgcagctgatacgcgagatgagcataatcgacccaaccagcaac
gagtttacttcgaagcacagcatggagtggaagttcctgtttctcgatcaccgcgcgccc
ccaatcattggctacatgccgttcgaggtgctgggcacctccggatacgattactatcac
gtcgacgacttggacaacattgtggcgtgccacgaagagttgcgacaaacgggcgaggga
aaatcctgctattaccgcttccttaccaagggccagcaatggatatggctgcaaacggac
tactttgtaagctatcatcaattcaacacgaagccggactacgttgtgtgcacccacaat
gttgtcagctatgcggaggtcatcaagcacactcagaaggagcgccagcaggcgagcagc
aaggactgcaaggcccagacctcgacggccagcagcagcaagccggcgacggccacgaca
acgctgagagacttggagctggccaatgagaatctggagagtaacctgctggacaatagc
ctatcgaaattgaccaatgaaacgactgccacctcacccgcagtggagtcgtcacccatg
tggtcagcgacggtgacggtagcggcagcggcagcatcgggctcgtgccaagcaaatcct
ctgaaaatagccaggccagcctcgagctatagcaacattagctctacgggtatctcgcca
aaagccaagcggaaatgttacttctacaacaacagaggcaatgattcggattccacttca
atgtctacggaatcaggcaccagcagacagtcgggagccagcaggcactccgtgttgacg
catgcgagttcgcaaagtcaacgacagcggtcacagcttcgtgatcacagtcaaagtcat
aataataaccatcaccagcagcagcagcagcagcaacagcaccaacagcagcaggcgcaa
cagcagcagcagcagcaacaacatctgcaacacctccagcaacagcagcagcagatccaa
cagcagctgcaacagaacgtggggccgcccaagctggtgcccatgctgcctatcggaccc
gcacagatcatggcaggcaacgcgtttccgcagtccccctatcctctggccagcccccag
ctggtggcgcctacttttctggaaccgcagcagttcctggcagccatacccatgcagcca
gtgatagggccgttcccggtgccgccagtccctgtcctctcgccgctggctgtgccgagt
caagggcaagggcagcaggaactactgcccggaagtgtggtgatgacgccgacgcaaagt
cagctgcaggatcagctgcagcgcaaacacgacgagctgcagaagctgataatgcagcaa
caggacgagctgcggattgtgtcggagcagctgctgctagcccgctatacgtacttccag
cccgtggtgcagatgggactctcaccgggcaacatagcaccgggcaacatgacaccgggc
agcatgacaccgggagctgcgatgcccaatgcggcgggtggcagcgttcagcagcgcgca
ttcaacttctcaagcacgaatgcagtgcagccgcattttaatcagtatggattcgcgctg
aactcggagcagatgcagaaccagcaggaccaacagatgatgatgcagcagcagcagaac
cttcacagtcagcagcagcataatctccatcagcagcatcagaatcagaatcaaatgcag
cagcagcaacatcttttggagcagcagcaattgcagctgcaacagcagcagcagaacgaa
atgttgtcgcgcgaggacattgaggacattgatgcctttctcaatctgtcgccgctgcaa
tcgctcgagcctccagctgcactaaaccctagccacaacaacaaccattccagctttaac
aatggcaacggcaacagcagtcagaacatcatcggccacaacaacagcaacaacaacaac
aacaacagcaacagcaacaacaacaacaacaacagcagctcgactgccccacagaatcac
aacgaagactccttgttgtcgtatatgcagatggccacaagcccttcggtcaacttccac
atgggcatcagtgatgattccgagacgcagagtgaagacaagatgaggatgggcagcagc
agtagccacctgcagctgcagcagcaacatctcctgcagcaacagcaacagcagcaacaa
caacaacaccagcagctaccagagtcgagcagtttttaccattcgaatccattcgtcgcc
cacctacagaatcagaatcaattgccaaacgacctggaaatattgccctttcaaatgtcg
caagagcaatcacagaatctattcgatgcatcaaacacagcccctggcggaagtcaataa

DBGET integrated database retrieval system