KEGG   Drosophila persimilis: Dper_GL17836Help
Entry
Dper_GL17836      CDS       T01063                                 

Definition
GL17836 gene product from transcript GL17836-RA
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 437 aa AA seqDB search
MLLVGNAIWKWSRLFGALLLLLGVLRTASGLSSRVLELSDRFIDVRHEGQWLVMFYAPWC
GYCKKTEPIFGLVAQALHATNVRVGKLDCTRYPASAREFKVRGYPTIMFIKGNMEFTYNG
DRSRDELVDYALRMSGPPVQLVTRTESVDMLKGSHTIFFMFVGQQEGVVWDTYYAAAEGY
QEHGFFYATSEDIAAQHFDFEKLPAVIVYKEEQHHFYPHGHVAHEMDPNEVNETIFQWVN
VERFTLFPKVTRFNIHQLLKTQKYLVLAVVQEDKLSQIATHELEFRDMVEGVIRKHRPRY
HNKFQFGWIGEPAIAHSIILDQLPTPHLIAINSSTQHHFIPDDDPMQMTPQALHLFLESI
SNESAIAYGGDTYFVRCNRALFELKRSLKDMWKGNPVLTTVIFGLPLGFLLLIMYSIFCG
DCLVTEEDQDEDHEKKE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcgtcggcaacgcaatctggaagtggagccgtctcttcggtgccctgctactg
ctgctgggagtgctcaggactgcctcaggcctatcctcgcgggtcctggagctgagcgat
cggttcatcgatgtccgtcacgagggccagtggctggtgatgttctatgccccgtggtgc
ggctactgcaagaagacggagccaatattcggtctggtggcgcaggcgctgcatgccacc
aatgtgcgggtggggaaactcgattgcaccaggtatccggcatctgcgcgcgagttcaag
gtgcgcggctatcccacgataatgttcatcaagggcaacatggagttcacctacaacggc
gaccggagtcgcgacgaactcgtggactatgccctgcgcatgtccgggccgcccgtgcag
ctcgtgacgcgcacagagagcgtggatatgctcaagggatcgcacacgatcttcttcatg
ttcgtcggccagcaggagggggtcgtctgggacacgtactatgcggcagcggagggctac
caggagcacggcttcttctatgccaccagcgaggacattgccgcccagcactttgacttc
gagaagctgccggcggttatcgtctacaaggaggagcagcaccacttctatccgcacggc
catgtggcccacgagatggaccccaacgaggtgaacgaaacgatcttccagtgggtcaat
gtggagcggtttaccctcttccccaaggtcacgcgcttcaacatccaccagctgctgaag
acccagaaatacctggtcctggccgtcgtccaggaggataaactcagccagatcgccacg
cacgagctggagttccgcgacatggtcgaaggcgttatccggaagcacaggccgcggtat
cacaacaaatttcagtttggatggattggcgagcccgccatcgcccattccatcatcctg
gaccagctgccgaccccgcatctgatagcgatcaattcgagcacccagcaccacttcata
cccgacgacgatcccatgcagatgacgccgcaggccctccacctcttcctcgagtccatc
agcaacgagagcgccatcgcgtatggcggcgacacctactttgtgcgctgcaatcgggcg
ctgttcgagctgaaacgttcgctgaaggacatgtggaaggggaatcccgtgctgacgacc
gtcatctttggcctgccgctgggcttcctcttgctgatcatgtactccatattctgcggt
gattgcctcgtcaccgaggaggaccaggacgaggatcacgagaaaaaggagtaa

DBGET integrated database retrieval system