KEGG   Drosophila persimilis: Dper_GL17874Help
Entry
Dper_GL17874      CDS       T01063                                 

Definition
GL17874 gene product from transcript GL17874-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dpe  Drosophila persimilis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dper_GL17874
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dper_GL17874
   00603 Glycosphingolipid biosynthesis - globo series
    Dper_GL17874
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dper_GL17874
   00511 Other glycan degradation
    Dper_GL17874
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dper_GL17874
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dper_GL17874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 607 aa AA seqDB search
MKRPAQPVALLLALAAIVVPIAANRSEDLVYGYECRTGLCRKVELSEENFSKAISLPVCR
LFCDSSIGTLWPKPTGPVRLDTLMRQVDISFIDFNITGIARKEKLWKAAENRWMDMVDAK
IPDRKILTRGGYRLTININTPDDAAPAKLTLETDESYSLNIDTDPSGHVVAIIAAANFFG
ARHGLETLSQLIVYDDIRREVQVTANASISDAPKFKWRGLLLDTSRNYYSVKAIKRTLDG
MALVKLNTFHWHITDSHSFPLELRKRPELYKLGAYSPRQVYSQRTVADIVEYGRVRGVRV
MPEFDAPAHVGEGWQHKNMTACFNAQPWKDFCVEPPCGQLDPTAEGLYDVLEDIYAEMWE
LFSPDIFHMGGDEVSTSCWNSSLPIRQWMKDQGWGLETADFMRLWGHFQTEALKRVDIVA
NGSQTPIILWTSHLTEEPFIDEYLNPERYIIQIWTTGGDPHVKKILERGFKTIVSNYDAL
YLDCGGAGWVSDGNNWCSPYIGWQKVYDNSMSAIAGDYEHHVLGAEAAIWSEQIDEHTLD
NRFWPRASALAERLWSNPAESWKQAESRLLLHRERLVENGLGAEALQPQWCLQNERECPI
DAYDAQA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggcctgcacaaccagtggccctgctcctggccctggctgccattgttgtaccc
atagccgcaaacagatctgaagacctggtctatggctatgaatgccgcactggactttgc
cgcaaggtggagctgagcgaggagaacttctccaaggctatcagtctgcccgtctgcagg
ctcttctgcgacagctccattggcacgctgtggcccaagccgacgggaccggttcgactg
gatacactgatgcgccaagtggacatctcgttcattgacttcaatattactggcatcgca
cgcaaggaaaaactatggaaggcagcggaaaaccggtggatggatatggtggatgccaag
atacccgatcgcaagatcctcacgaggggcggctatcggctcaccatcaacatcaacacc
ccggatgatgcggctcctgccaaacttaccctggaaacggacgaaagctatagtctcaac
atagacaccgatccgtctggccatgtggtggctatcatagctgcggccaacttctttggt
gcccggcatggcctggagactctctcccaactgattgtctacgatgacattcggcgcgag
gttcaggtgacggccaacgcttccatcagcgatgctcccaaattcaagtggcgcggcctg
ctcctggatacctctcgcaattactactccgtgaaggcaatcaagcgaactcttgatgga
atggccttggtcaagctgaacaccttccactggcacattaccgactcgcacagcttcccc
ctggagctgcgcaagcgaccagagctatacaagctgggtgcctactcgccccgccaggtg
tatagccagcggactgtggccgacatcgtggagtatggtcgagtgcgcggagtccgcgtg
atgccagaattcgacgcccctgcccatgtgggcgagggatggcagcacaagaacatgacg
gcctgcttcaatgctcagccctggaaggatttctgcgtggagccaccttgtggacagctg
gatcccactgcggaggggctctatgatgtgctagaggacatttacgccgagatgtgggag
ctcttcagcccagatattttccacatgggcggcgacgaggtatccaccagttgctggaac
agcagtctgccaatccgccaatggatgaaggatcagggctggggcctggagactgctgat
ttcatgcgcctgtggggacacttccagaccgaggcccttaaacgggtggacattgtggcc
aacggatcacaaacgcctatcattctgtggaccagtcatctcacggaggagccttttatc
gatgagtacttgaacccggagcgttatattatccagatttggacgacgggcggcgatcct
catgtgaagaaaatactagagcggggcttcaagacaattgtctcaaactacgatgccctc
tacttggactgcggcggagctggatgggtgagcgacggcaacaactggtgctccccctac
attggatggcagaaggtgtatgacaacagcatgtcggccattgccggcgactacgagcat
catgtgctgggcgccgaggcagccatttggtccgagcaaatcgatgagcataccctggac
aacaggttctggccgcgggccagtgctctggccgaacgcctctggtcgaatcccgccgag
agctggaaacaggccgagtcgcgtctgctgctccaccgggagcggctggtggagaacggc
ctgggcgccgaggccctgcagccccaatggtgtcttcagaatgaacgcgaatgccccatt
gacgcgtatgatgcacaagcttga

DBGET integrated database retrieval system