KEGG   Drosophila persimilis: Dper_GL17965Help
Entry
Dper_GL17965      CDS       T01063                                 

Definition
GL17965 gene product from transcript GL17965-RA
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dper_GL17965
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dper_GL17965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 324 aa AA seqDB search
MSEGAGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQ
EDEPAGKVVLDKEDIFFAKQVINNACATQAILSLLMNLEHEDIKLGETLANFKEFCQCFD
PYNKGLTLSNASQIRTVHNSFARQTLFELDMKNQSKDEDLYHFVGYIPIKGRLYELDGLR
EGPIDLGEIKPDQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEKQIDKLLNP
APDAMDTEEDRQTEISSLRSYIQYEVQKKKRYKVENVRRKHNYLPFIVELLKMLGETGQL
MPIYEKAKQRALEREQAQRKKESN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaggtgctggcaactggtgtctcattgagagcgatccgggcgtgttcacggag
ctgattcgcgaatttggttgcgatggcgctcaagtggaggaaatatggagcctggacagt
gaatcgttcaagaacctggagcctatacacggattgatatttctcttcaaatgggtgcag
gaggacgaacccgctggcaaggtggtgctggacaaggaagatatattctttgccaagcaa
gtgatcaacaatgcatgcgccacgcaggccattctcagtttgctgatgaacctggaacac
gaggacatcaaactgggcgagacgctggccaacttcaaggaattttgccagtgcttcgat
ccctacaacaagggcctgacgttgagcaatgcctcccagatacgcacagtgcacaactcc
ttcgcccggcagactctcttcgagctggacatgaagaaccagagcaaggacgaggatctc
taccactttgtgggatatatccctattaaaggacgtttgtatgagcttgatggcctccgc
gagggacccatcgatcttggtgagatcaagccggatcaaaactggattgatgtggtgcga
ccaatcattgagaagcgcatgcaacgctacagcgacggtgagatccactttaacctgatg
gccctgatctcggaccgtcagcgcatctacgagaagcagatagacaagctgctcaatccg
gctcccgatgccatggatacagaggaagatcgtcagactgaaattagcagcttgcgctcc
tacatccagtacgaggtccagaagaaaaagcgctacaaggtggagaacgtgcgtcgcaaa
cataactacttgcccttcatcgtggagctgctgaaaatgctgggcgagaccggccagctg
atgcccatctacgagaaggccaagcagcgcgcgctggaacgcgaacaggcgcaacgcaaa
aaggagtccaactaa

DBGET integrated database retrieval system