KEGG   Drosophila persimilis: Dper_GL18042Help
Entry
Dper_GL18042      CDS       T01063                                 

Definition
GL18042 gene product from transcript GL18042-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dpe  Drosophila persimilis
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dpe03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dpe04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 204 aa AA seqDB search
MASAQGKGGVEENPKKEQKQQDKPKEQTNGEKEKDTTNGPAAACPRHSRHPLENVWTLWY
LENDRSKHWKDMLTEVAKIDSVETFWSLYYTIRPPSELKVGCDYSMFKLGHQICGAVINI
RSKNNKICKCPKWDSYPDTKHPLMPAAATPLAVWTANGSNEAAILEIGQKLKLFLRLQSN
NLQYQLHSDAMCKSNSSVKSIYTV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgctcaaggaaaaggcggagtggaggagaaccccaagaaggagcagaagcag
caggataagccgaaggagcagaccaacggtgagaaggaaaaggacaccaccaatgggccg
gcggcagcatgcccgcgacacagccgccatccgctggagaacgtgtggaccctgtggtac
ttggagaacgatcgcagcaagcactggaaggacatgctcaccgaagtcgcgaagatcgac
agcgtggagaccttctggagcctgtactacaccatccggccgccatcggagctgaaggtc
ggatgcgactactccatgttcaagctggggcatcaaatctgcggggcagtgatcaatatt
cgatccaagaacaataagatctgtaagtgcccgaaatgggattcgtatccagacacaaaa
caccccctaatgcccgctgccgctactcctttagccgtttggactgccaacgggagcaac
gaagcagccattctggagattggccagaagctgaagctgttcctccgcctgcagtcgaac
aatctgcagtaccagctgcactcggacgccatgtgcaagtccaattcgagcgtcaagtcg
atctacaccgtctaa

DBGET integrated database retrieval system