KEGG   Drosophila persimilis: Dper_GL18052Help
Entry
Dper_GL18052      CDS       T01063                                 

Definition
GL18052 gene product from transcript GL18052-RA
Orthology
K01446  
N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     Dper_GL18052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 353 aa AA seqDB search
MSNVPISAAVRSLSEERTREWLEAQSAPDEDEVESIAESSVVDSLDYEYSEYTQDEDDED
NENTGEEISTMPLGTSITNKRSKISDTLRDLMNSINSIQTVGNVNISNSTNVHIGNVTNI
NGNIQIIANSLSRARHDRRKTSLTEVPAPDIEPNLLSKDESEERVCSDVFINSQKFKIPK
ELCSIIPRHSWLAQSPMEEPEVLQRPVKYVVILHTATESSEKRAINVRLIRDMQCFHIES
RRWNDIAYNFLIGCDGNIYEGRGWRTVGAHTLGYNKIALGISFIGCFMRELPTTDALNMC
RNLLARGVEDGHIASDYRLICHCQCNSTESPGRRLYEEIQAWPHFYNIEKEKQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgtacctatatcggcagcggttaggtcattaagtgaggaacgaactcgggaa
tggctggaagcacagagtgctccagatgaggatgaggtagaatcaattgccgaatcatcg
gtggtggacagcctggattatgaatacagcgaatacacccaggatgaagatgacgaagac
aacgaaaacacaggagaggaaattagtacgatgccattgggcacttccatcacgaacaag
cgttccaaaatcagtgacactctacgagacctgatgaactctatcaacagcattcaaact
gtgggaaatgttaacatcagtaattctacaaatgtgcatattggaaatgtgaccaacatc
aatggaaacatacagatcatagccaacagcttgagtcgagctcgacacgatcgtcgaaaa
acttcactcactgaggttccagctccggacattgaaccaaatttacttagcaaggacgaa
tcggaagagcgagtttgctccgatgtatttattaacagtcaaaagttcaaaataccaaag
gagctgtgttccattattccccgacattcctggctggcccaaagccccatggaggagcca
gaagtactacagcgtcccgttaaatatgtggtcattttacacacggcaaccgagagttcc
gagaagcgcgccataaatgtgcgacttatccgtgacatgcagtgctttcacatcgaatca
cggagatggaatgacattgcttataattttctaattggttgtgatggcaacatctacgag
ggacgcggctggcgtacggttggagcgcacacactgggatacaacaagatcgcactgggc
atcagtttcatcggttgcttcatgcgagaattacccacgacggatgctttgaacatgtgc
cgcaatctgttggcgcgcggtgttgaggatggccacattgcatccgattatcgacttatc
tgtcactgccaatgcaactcaacggaaagtccaggccgacggttgtatgaggagatacag
gcctggccacatttctataatattgagaaggagaaacagtag

DBGET integrated database retrieval system