KEGG   Drosophila persimilis: Dper_GL18348Help
Entry
Dper_GL18348      CDS       T01063                                 

Definition
GL18348 gene product from transcript GL18348-RA
Orthology
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
dpe  Drosophila persimilis
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dpe00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1046 aa AA seqDB search
NFHFLVGSSEMAGAGTGLGSGSGSGSGGSTSGNGKLKAGASLSRSWPLEECDGSLLGHFG
RVRHPSIPSLYDSERFGGSGGPTGGSASPSGSLVGVEGKSQPMSSIQNDFYDQEFSTHIE
RNPRERLLRHIGAVKDANLETTELVEGESLTAWTALPRLTRFPGLILLNNNSRCHGRMSP
VALAEDPLTMRMPTSPLLRTCAEELRKGQQMELGGGHGNSNNNNNNYQQKNQNVILSLHS
STTDNIAGVLRDLANLLHLTPALTCKLIEEKSDPKTGSEPSLDQPKSQGAKEEADEQAEK
EPFKRPLSASNGHLRKILNGRRKLCRSCANVVPASGLRVPSQSMPPLEEQLPRLAQLMAL
LPRKTPPPPFFYFCDRACLALFKWSGKEVQAKAEAASISLLAASGSSKSTLASGSCPAVP
PEHVVKTEPPEEELDVKQSLGSETAAPPLQRKCIVKCFSGDCFATESSASTDIKQEYDGA
TSFAAPNNTVWETDVVSHLEDTRQCVFCNQRGDGQADGPSRLLNFDVDKWVHLNCALWSN
GVYETLSGALMNFQTALQAGLNQACSACHQLGATIKCFKSRCNNLYHLPCAIREECVFYK
NKSVHCSAHGHAHTHAQAHAGSGSANAGSGSGSGSGATFGPMENELSSFVVHRRVFVDRD
EYRQVTSVMHYTELSNLLRVGNMTFLNVGQLLPHQLEAFHTPHFIYPIGYKVSNRYYWCV
RRPNRRCRYICSIAEAGCKPEFRIVVQDGSDKEPEREFQASTPTGVWQQILQPITRLRKV
HKWLQLFPQHISGEDLFGLTEPAIVRILESLPGIETLTDYRFKYGRNPLLEFPLAINPSG
AARTEPKQRQLLVWRKPHTQRTAGSCSTQRMANSASIAGEVACPYSKQFVHSKSSQYKKM
KQEWRNNVYLARSKIQGLGLYAARDIEKHTMIIEYIGEVIRTEVSEIREKQYESKNRGIY
MFRLDEDRVVDATLSGGLARYINHSCNPNCVTEIVEVDRDVRIIIFAKRKIYRGEELSYD
YKFDIEDDAHKIPCACGAPNCRKWMN
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
aactttcacttccttgttgggagcagcgagatggcgggcgcaggaacgggattgggatcg
ggatcgggatccggatcgggagggtccacctccggcaacggcaagctaaaggccggcgcc
tccctatcccgcagctggccgctggaggaatgcgacggatcgctgctgggccacttcggt
cgggtgcgccatcccagtattccctcgctgtacgacagcgaacgcttcggcgggagcggg
ggcccgacggggggctctgcatctccgtcggggtctctggtgggagtggagggaaagtcg
cagcccatgtccagcatccagaacgacttctacgaccaggagttctccacccacatcgag
cggaatccccgcgagcggctgctgcggcacatcggggccgtgaaggacgcaaacctggag
accacagagctggtggagggcgagtccctgaccgcctggacggcccttccgcggctcacc
cgctttccgggcctaattctgctgaacaacaacagtcggtgccacgggcggatgtcgccg
gtggccctggccgaggaccccctcaccatgcggatgcccacttcgcccctgctccgcacc
tgcgccgaggaactgcgcaagggccagcagatggagctggggggcggccacggcaacagc
aacaacaacaacaacaactatcagcagaagaaccagaacgtgatactctcgctgcactcc
tcgacgacggacaacatagccggcgtgctgcgggatctggccaatctgctgcacctgacg
cccgcccttacatgcaagctcatcgaggagaagtcggacccgaagaccggctccgagccc
agcctcgaccagccaaagagccagggagccaaggaggaggccgacgagcaggccgaaaag
gagccgttcaagcggcccctctccgcgagcaacggccacctgaggaagattctcaacggg
cgacgcaagctgtgccgcagctgtgccaacgtcgtccccgccagcggcctgcgggtgccc
agccagagcatgcctccgctggaagagcagctgccccggctggcccagctaatggcgctg
ctgccccggaagacgccgccgcctccgttcttctacttctgcgatcgtgcctgcctggcc
ctgttcaagtggagcgggaaggaggtccaggcaaaggccgaggcggccagcatctctctg
ctcgcggccagcgggtcctcgaagagcactttggcgtcgggctcgtgtccggccgttcct
ccagagcatgtggtgaagacggagccgccggaggaggagctcgacgtgaagcagagcttg
ggcagcgagaccgctgcgcccccactgcagcgcaagtgcatcgtcaagtgctttagcggc
gactgcttcgccacggaatcgtccgcgagcacggacatcaagcaggagtacgatggagcc
acttcatttgctgcccccaacaacacggtgtgggagacggacgtggtcagccacctagag
gacacgcgccagtgcgtcttctgcaaccaacgcggcgacggccaggcggacggaccctcg
cggctgctcaacttcgatgtggacaaatgggtccatctcaactgtgccttgtggtcgaac
ggcgtgtacgagacgctgtccggagcgctgatgaacttccagaccgcactgcaggcgggg
ctgaatcaggcgtgcagcgcttgccaccagctgggagctaccatcaaatgcttcaagtcg
cgctgcaacaacctctaccacctgccctgcgccattcgggaggagtgcgtcttctacaag
aacaagtccgtgcactgcagtgcccatggccatgcccacacccacgcccaggcccacgca
ggcagcggaagtgccaatgccggatccgggtccgggtctgggtctggagccactttcggg
ccaatggagaacgagctaagctccttcgttgtgcaccgtcgggtgttcgtggaccgcgac
gagtaccgtcaggtgacctccgtcatgcattacacggagctgagcaacctgctgcgggtg
ggcaacatgacgttcctcaatgtgggccagctgctgccccaccagctggaggccttccac
acgccccatttcatctaccccattggctacaaggtgagtaatcgctactactggtgcgtg
cggcgtccgaatcggcggtgccggtacatctgctccatagccgaggccggctgcaagcct
gagttccggatcgttgttcaggacggcagcgacaaggagccggagcgcgagttccaggcc
agcacgccaacgggggtgtggcagcagatcctgcagcccatcacccgcctgcggaaggtg
cacaagtggctgcagctcttcccgcaacacatcagcggcgaggacctcttcgggctaacg
gagccggccattgtgcgcatcctggagagcctgcccgggatcgagacgctcaccgactac
cgattcaagtacggccgcaacccgctgctggagttcccgctggccatcaatccgtccggc
gccgcccgcaccgagcccaagcaacggcagctgctcgtctggcgcaagccgcacacccag
cggaccgcaggcagctgcagcacccagcgcatggccaactcggcgtcgattgccggagag
gttgcctgcccctacagcaagcagttcgtccactccaagagctcccagtacaaaaagatg
aagcaggagtggcgcaacaacgtctacttggcgaggtcgaagattcagggcctgggcttg
tatgcggcccgagatattgaaaagcacaccatgatcatcgagtatattggggaggtcatt
cgcaccgaggtttccgagatacgggagaagcagtacgaatccaagaatcgaggcatttac
atgttccgccttgacgaggatcgcgtcgtagacgccactctgagcggcggcctggctcgc
tacatcaaccactcctgcaatccgaactgtgtgacggagattgttgaggtcgatcgcgat
gtgcggatcataatattcgccaagcgtaaaatttatcgtggcgaggagctctcgtatgac
tacaagtttgacatagaggatgatgcacacaagataccgtgtgcctgtggcgctcccaat
tgtcgcaagtggatgaactaa

DBGET integrated database retrieval system