KEGG   Drosophila persimilis: Dper_GL18348Help
Entry
Dper_GL18348      CDS       T01063                                 

Definition
GL18348 gene product from transcript GL18348-RA
Orthology
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
dpe  Drosophila persimilis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dper_GL18348
Enzymes [BR:dpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dper_GL18348
Transcription factors [BR:dpe03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    Dper_GL18348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1046 aa AA seqDB search
NFHFLVGSSEMAGAGTGLGSGSGSGSGGSTSGNGKLKAGASLSRSWPLEECDGSLLGHFG
RVRHPSIPSLYDSERFGGSGGPTGGSASPSGSLVGVEGKSQPMSSIQNDFYDQEFSTHIE
RNPRERLLRHIGAVKDANLETTELVEGESLTAWTALPRLTRFPGLILLNNNSRCHGRMSP
VALAEDPLTMRMPTSPLLRTCAEELRKGQQMELGGGHGNSNNNNNNYQQKNQNVILSLHS
STTDNIAGVLRDLANLLHLTPALTCKLIEEKSDPKTGSEPSLDQPKSQGAKEEADEQAEK
EPFKRPLSASNGHLRKILNGRRKLCRSCANVVPASGLRVPSQSMPPLEEQLPRLAQLMAL
LPRKTPPPPFFYFCDRACLALFKWSGKEVQAKAEAASISLLAASGSSKSTLASGSCPAVP
PEHVVKTEPPEEELDVKQSLGSETAAPPLQRKCIVKCFSGDCFATESSASTDIKQEYDGA
TSFAAPNNTVWETDVVSHLEDTRQCVFCNQRGDGQADGPSRLLNFDVDKWVHLNCALWSN
GVYETLSGALMNFQTALQAGLNQACSACHQLGATIKCFKSRCNNLYHLPCAIREECVFYK
NKSVHCSAHGHAHTHAQAHAGSGSANAGSGSGSGSGATFGPMENELSSFVVHRRVFVDRD
EYRQVTSVMHYTELSNLLRVGNMTFLNVGQLLPHQLEAFHTPHFIYPIGYKVSNRYYWCV
RRPNRRCRYICSIAEAGCKPEFRIVVQDGSDKEPEREFQASTPTGVWQQILQPITRLRKV
HKWLQLFPQHISGEDLFGLTEPAIVRILESLPGIETLTDYRFKYGRNPLLEFPLAINPSG
AARTEPKQRQLLVWRKPHTQRTAGSCSTQRMANSASIAGEVACPYSKQFVHSKSSQYKKM
KQEWRNNVYLARSKIQGLGLYAARDIEKHTMIIEYIGEVIRTEVSEIREKQYESKNRGIY
MFRLDEDRVVDATLSGGLARYINHSCNPNCVTEIVEVDRDVRIIIFAKRKIYRGEELSYD
YKFDIEDDAHKIPCACGAPNCRKWMN
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
aactttcacttccttgttgggagcagcgagatggcgggcgcaggaacgggattgggatcg
ggatcgggatccggatcgggagggtccacctccggcaacggcaagctaaaggccggcgcc
tccctatcccgcagctggccgctggaggaatgcgacggatcgctgctgggccacttcggt
cgggtgcgccatcccagtattccctcgctgtacgacagcgaacgcttcggcgggagcggg
ggcccgacggggggctctgcatctccgtcggggtctctggtgggagtggagggaaagtcg
cagcccatgtccagcatccagaacgacttctacgaccaggagttctccacccacatcgag
cggaatccccgcgagcggctgctgcggcacatcggggccgtgaaggacgcaaacctggag
accacagagctggtggagggcgagtccctgaccgcctggacggcccttccgcggctcacc
cgctttccgggcctaattctgctgaacaacaacagtcggtgccacgggcggatgtcgccg
gtggccctggccgaggaccccctcaccatgcggatgcccacttcgcccctgctccgcacc
tgcgccgaggaactgcgcaagggccagcagatggagctggggggcggccacggcaacagc
aacaacaacaacaacaactatcagcagaagaaccagaacgtgatactctcgctgcactcc
tcgacgacggacaacatagccggcgtgctgcgggatctggccaatctgctgcacctgacg
cccgcccttacatgcaagctcatcgaggagaagtcggacccgaagaccggctccgagccc
agcctcgaccagccaaagagccagggagccaaggaggaggccgacgagcaggccgaaaag
gagccgttcaagcggcccctctccgcgagcaacggccacctgaggaagattctcaacggg
cgacgcaagctgtgccgcagctgtgccaacgtcgtccccgccagcggcctgcgggtgccc
agccagagcatgcctccgctggaagagcagctgccccggctggcccagctaatggcgctg
ctgccccggaagacgccgccgcctccgttcttctacttctgcgatcgtgcctgcctggcc
ctgttcaagtggagcgggaaggaggtccaggcaaaggccgaggcggccagcatctctctg
ctcgcggccagcgggtcctcgaagagcactttggcgtcgggctcgtgtccggccgttcct
ccagagcatgtggtgaagacggagccgccggaggaggagctcgacgtgaagcagagcttg
ggcagcgagaccgctgcgcccccactgcagcgcaagtgcatcgtcaagtgctttagcggc
gactgcttcgccacggaatcgtccgcgagcacggacatcaagcaggagtacgatggagcc
acttcatttgctgcccccaacaacacggtgtgggagacggacgtggtcagccacctagag
gacacgcgccagtgcgtcttctgcaaccaacgcggcgacggccaggcggacggaccctcg
cggctgctcaacttcgatgtggacaaatgggtccatctcaactgtgccttgtggtcgaac
ggcgtgtacgagacgctgtccggagcgctgatgaacttccagaccgcactgcaggcgggg
ctgaatcaggcgtgcagcgcttgccaccagctgggagctaccatcaaatgcttcaagtcg
cgctgcaacaacctctaccacctgccctgcgccattcgggaggagtgcgtcttctacaag
aacaagtccgtgcactgcagtgcccatggccatgcccacacccacgcccaggcccacgca
ggcagcggaagtgccaatgccggatccgggtccgggtctgggtctggagccactttcggg
ccaatggagaacgagctaagctccttcgttgtgcaccgtcgggtgttcgtggaccgcgac
gagtaccgtcaggtgacctccgtcatgcattacacggagctgagcaacctgctgcgggtg
ggcaacatgacgttcctcaatgtgggccagctgctgccccaccagctggaggccttccac
acgccccatttcatctaccccattggctacaaggtgagtaatcgctactactggtgcgtg
cggcgtccgaatcggcggtgccggtacatctgctccatagccgaggccggctgcaagcct
gagttccggatcgttgttcaggacggcagcgacaaggagccggagcgcgagttccaggcc
agcacgccaacgggggtgtggcagcagatcctgcagcccatcacccgcctgcggaaggtg
cacaagtggctgcagctcttcccgcaacacatcagcggcgaggacctcttcgggctaacg
gagccggccattgtgcgcatcctggagagcctgcccgggatcgagacgctcaccgactac
cgattcaagtacggccgcaacccgctgctggagttcccgctggccatcaatccgtccggc
gccgcccgcaccgagcccaagcaacggcagctgctcgtctggcgcaagccgcacacccag
cggaccgcaggcagctgcagcacccagcgcatggccaactcggcgtcgattgccggagag
gttgcctgcccctacagcaagcagttcgtccactccaagagctcccagtacaaaaagatg
aagcaggagtggcgcaacaacgtctacttggcgaggtcgaagattcagggcctgggcttg
tatgcggcccgagatattgaaaagcacaccatgatcatcgagtatattggggaggtcatt
cgcaccgaggtttccgagatacgggagaagcagtacgaatccaagaatcgaggcatttac
atgttccgccttgacgaggatcgcgtcgtagacgccactctgagcggcggcctggctcgc
tacatcaaccactcctgcaatccgaactgtgtgacggagattgttgaggtcgatcgcgat
gtgcggatcataatattcgccaagcgtaaaatttatcgtggcgaggagctctcgtatgac
tacaagtttgacatagaggatgatgcacacaagataccgtgtgcctgtggcgctcccaat
tgtcgcaagtggatgaactaa

DBGET integrated database retrieval system