KEGG   Drosophila persimilis: Dper_GL18373Help
Entry
Dper_GL18373      CDS       T01063                                 

Definition
GL18373 gene product from transcript GL18373-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 632 aa AA seqDB search
MILYMHKLTPYERTEILAYPQIYFIGANAKKRPGVYGPNNSDYDNEQGAYIHIPHDHVAY
RYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYN
TMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALY
KNEIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGAKYG
RAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKTLLATSKRSKTFFSPKG
YPRYCTVRTMSDGMVVLIGGQSRRGKPRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDA
DKRLTPSEALKHPWLRRRLPRPPSSSSGCGVLNGANVSGDQSPVTGLNITSANETTASAS
SAISASLTMERENSNCSGRVNHGGISEEEFKSTISLNGSDGSLPAPAAAFLTADLLADSF
KNTTVISPHLSSLTHSADSSCVSGLSTVARSVVTSRHPPSSLSYLPHMNNNGTERLSSFS
ASLNSSANSLTQLEPVINLDVFSVYSASTTPNLTATDIGLVSDSVTEDMDMTASSSFVNL
SNTCVMDKSSGINENKNFSQHAHNFKVSSKDM
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgatattgtacatgcataaattaactccatatgagcgtactgaaatactagcgtatcca
cagatttatttcattggtgccaatgcaaaaaaacgcccaggagtgtacggaccaaacaat
tctgattatgataatgaacaaggggcttatattcatataccccacgatcacgtagcgtat
cgatacgaaatgctcaagataattggcaagggaagcttcggccaggtgataaaggcctat
gatcataagactcacgagcatgtagcattaaaaatagtgcgcaatgagaagcggtttcat
cggcaagcacaagaggaaattcgaattcttcatcatttacgtcgtcacgataaatataat
actatgaatatcatacacatgtttgactactttacatttcgaaatcacacttgcatcaca
ttcgagcttctcagcattaacctttatgaattgattaagaaaaatggatttaagggcttc
agcctacagcttgtgcgaaaatttgcacattcgctactccaatgcttggatgcgctatac
aaaaatgagattatacattgtgatatgaaaccagaaaatgtgcttttaaaacaacaaggt
cgttctggtattaaggttattgactttggttcgtcatgctttgaaaatcaacgcatatat
acatatatacaatcacgattttaccgtgcccctgaggttattttgggagcaaaatatggc
agagctattgacatgtggtccttgggttgcattctggcagaactactatcgggtcacgca
ctgtttccgggtgaaaacgaaagcgatcaacttgcctgtattattgaagttctcggcatg
cccaataaaacgttactagccacctcaaagcgatccaaaacgttctttagcccaaaaggt
tatccacgttattgcactgtacgcaccatgtctgatggaatggttgtgttaattgggggc
cagtcgcgccgaggaaagccacgaggtcccccatgctcaaaaagcctttctaaagcactg
gatggatgcaaggatccgctatttctcaactttattcgtggttgtctggaatgggatgca
gataaacgcttaactccatcggaggctcttaaacatccgtggcttcgccgtcgtcttccc
agaccaccaagtagctcaagcggttgtggtgttttaaacggagctaatgtcagtggtgat
caatcaccggtaacaggactaaatataacttctgcaaatgaaacgactgcatctgcaagc
tctgctatatctgcctcattaacaatggaaagagagaacagcaattgtagtggtcgtgta
aaccatggcggaatttctgaagaagaatttaaaagtaccataagtctcaacggctcggac
ggatcgttaccagcgccagctgctgctttcttaacagccgaccttttggcggatagtttt
aaaaatactactgttatatcgccacatttgtcgtcgttaacccattcagctgattccagt
tgcgttagtggtctcagtacagtcgctcggagtgttgttacttccagacatccaccgtca
tcattatcgtatttgccgcacatgaacaataatggaactgaacgtttatctagcttttct
gcctcgttaaacagctctgccaactcattgacgcaattggaaccggtcataaacttagat
gtattctccgtatattcagcttcaaccacacctaatttaacagcaaccgatataggtttg
gtttcagattctgttacggaagatatggacatgacagcttcgtcctcttttgttaatctc
agtaacacctgcgtaatggataagtccagtggtatcaatgaaaataaaaacttttcacag
cacgcccataattttaaagtatcttccaaagatatgtag

DBGET integrated database retrieval system