KEGG   Drosophila persimilis: Dper_GL18418Help
Entry
Dper_GL18418      CDS       T01063                                 

Definition
GL18418 gene product from transcript GL18418-RA
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dpe  Drosophila persimilis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dper_GL18418
   00052 Galactose metabolism
    Dper_GL18418
   00500 Starch and sucrose metabolism
    Dper_GL18418
   00520 Amino sugar and nucleotide sugar metabolism
    Dper_GL18418
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dper_GL18418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 513 aa AA seqDB search
MLDVPNEGKVRGHQRVPSDSKEFHEVTKRDALRLLENDVDRLLQTTEQVRRPALQAEMGR
FADLFGRFLQEEGPALDWNKIQKLPENAVMNYSNLKLPKNEQNEIRNMLDKLVVIKLNGG
LGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVR
KYKGFRVQIHTFNQSCFPRISREHFLPVAKDFDVEKDMEAWYPPGHGDFYDTFRNSGLLK
KFIEEGREYCFLSNIDNLGATVDLNILNKLVGEERASTPVEFVMEVTDKTRADVKGGTLI
QFENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLASIDRVLRERTLSMEIIVNN
KTLETGLRVIQLETAVGSAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSL
VMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGT
VIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtgcccaatgaaggaaaggtgcgtggccaccagcgagtgccctccgattcg
aaggagttccatgaggtcaccaagcgggatgctctgcggctgctggagaacgatgtggac
cgtctgctccagacaacagaacaggtgcgtcggccagccctccaggcggagatgggtcgc
tttgccgatctctttggacgcttcctgcaggaggagggtcccgctttggactggaacaag
atccagaagctgccagaaaatgctgtgatgaactattcgaacctaaagttgccaaagaac
gagcagaatgagatacgcaatatgctggacaaattggtggtcattaagctgaacggtggc
ctgggcacttccatgggttgtcatggacccaagagtgtgattcccgtcagatctgatttg
acgtttttggatctgaccgtccagcagatcgagcatctgaacaagacctacgatgccaat
gtgccgctggtgctgatgaactcctttaacaccgatgaggataccgagaagattgttcgg
aaatacaagggcttccgcgtgcagatacacaccttcaatcagagctgctttccgcgcatc
agtcgcgagcattttctgcctgtggccaaggactttgatgtggagaaggatatggaggct
tggtatccacctggtcatggcgacttttacgacactttccgcaactctgggctgctgaag
aagttcatcgaagagggacgcgaatattgtttcctctccaacattgacaatctgggcgcc
accgtggatttgaatatactcaataagctggtgggcgaggagcgggccagcactccagtg
gaatttgtcatggaagtcactgacaagacacgggctgatgtcaagggtggcactctcata
cagttcgagaacaagctgcggctgctggaaatcgcccaagtgccgccagagcatgtagat
gactttaaatcggtgaagaccttcaagttcttcaacaccaacaacatttgggccaatcta
gcatccatcgatcgggtcttgcgggagcgcaccttgagtatggagattattgtgaacaac
aaaacgctagaaacgggtctgcgtgtcattcaattggagacagctgtgggttcggccatg
aagtgctttgatggcgcaattggcatcaatgtacctcggtcgcgcttcttgcccgtgaag
aagtcttccgatctgcttttggtcatgtccaatttgtatacgttgaagaacggcagccta
gtgatgtcgccgcagcgcatgttccccaccacgccactggtgaagctgggcgagaatcac
ttctccaaggtgaaggagtttctgggtcgctttgccaatatacccgacattattgagctt
gatcatttgacggtcagtggagacgtgacctttggccgtggtgtttctttgaggggcact
gtgatcatcattgccaatcatggggatcgtattgatatacccgctggggctatcctagag
aacaagattgtctctggcaatatgcgcatcctggaccattaa

DBGET integrated database retrieval system