KEGG   Drosophila persimilis: Dper_GL18482Help
Entry
Dper_GL18482      CDS       T01063                                 

Definition
GL18482 gene product from transcript GL18482-RA
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dpe  Drosophila persimilis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dper_GL18482
Enzymes [BR:dpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dper_GL18482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 437 aa AA seqDB search
MRQLSSLLLLAFIASGSVNAFYSPSDGVVELTPSNFDREVVQDDAVWIVEFYAPWCGHCQ
SLVPEYKKLAKALKGVVKVGSVNADSDSTLSGQFGVRGFPTIKIFGSNKRSPTDFNGQRT
AKAIAEAALAEVKKKVQAALGGGSSGGGGGSSSSSDDDVIELTEDNFDKLVLNSDDIWLV
EFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFAAGS
KSASDAQEYQGGRTASDIVSWASDKHTENVPAPELVEITSESTLDSTCEGKPLCIISILP
HILDCDAKCRNKFLATLRTLGDKYKQKLWGWAWAEGGQQPALEESLEVGGFGYPALAVVN
FKKMKFSVLKGSFSKDGINEFLRDISYGRGHTAPVRGAKKPTIASVDPWDGKDGQLPTEE
DIDLSDIDLDDDVKDEL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagacagctgtcgagccttttgttgttggcattcattgccagcggcagtgtcaatgcc
ttctattcgccctccgatggcgtcgtggagttgacgccctccaatttcgatcgcgaagtc
gtgcaagatgatgccgtctggattgtggaattctatgccccgtggtgcggccactgccag
tctttggtgccggagtataagaagttggccaaagccctgaagggcgtcgtcaaggtgggc
tccgtcaatgccgattccgacagcaccctcagcggccagttcggagtacgtggctttccc
accatcaagatctttggcagcaacaagcgttcgcccacggactttaatggccagcgcaca
gctaaggcaattgcggaggcggctcttgccgaggtaaagaagaaggtgcaagcagctctg
ggcggcggaagcagcggcggcggtggcggaagcagctcatccagcgatgatgatgtcatt
gaattaaccgaagataacttcgacaagctggtgctcaactcagatgacatttggctggtg
gagttcttcgcgccgtggtgcggacattgcaaaaatctggcacccgaatgggccaaggct
gccaaggagctcaagggcaaggtgaagctgggcgccttggacgccaccgcccaccagagc
aaggcggccgagtacaatgttcgcggttatccgacaatcaagttcttcgctgccggctcg
aagagtgccagcgatgctcaggaatatcagggtggacgcacagcctcggacattgtcagc
tgggccagtgacaagcatacggagaatgtgcccgctcccgagctggtagaaatcaccagc
gaatccaccctagatagcacctgcgagggcaagcccctgtgcattatctctattctgcca
cacattctagactgcgatgccaagtgccgcaacaagttcctcgccacactgcgcaccctg
ggcgataagtacaagcagaagctgtggggctgggcctgggctgagggtggccagcagccg
gctctggaggagtccctggaagttggaggctttggctatcccgctctggcagtagttaat
tttaagaaaatgaagttctcagtgctgaagggctccttctccaaggacggcatcaacgag
ttcctacgcgacatctcatacggacgcggtcacacggctcccgtgcgtggcgccaagaag
cccacgattgccagcgtcgatccctgggatggcaaggatggccagctacccaccgaagag
gacatcgatctgagcgacattgatctggatgatgatgtcaaggatgagctctag

DBGET integrated database retrieval system