KEGG   Drosophila persimilis: Dper_GL18491Help
Entry
Dper_GL18491      CDS       T01063                                 

Definition
GL18491 gene product from transcript GL18491-RA
Orthology
K17501  
protein phosphatase 1E [EC:3.1.3.16]
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 436 aa AA seqDB search
MSADSIKEPAAPAAECAHMLEFKEFLASTAAKASATTEDLTRNCVTRTCNETYKVSVEER
HAELVAAIWQQLNSRGCPAVFRLKLLHQATQLLEKEICYAKECEVSVEGPTQYDLLKLQK
FVSNQMDKLLIKLTDNSEMERLKNYADEGVICQSPEHCMCGLAQTALHTSAAVKNKPRKM
EDRHVCLDRFGAIYELRNRDCRFFGVFDGHSGSLSASYVRSQLPQLLADQLRQADQQTET
QSSDFYRNAFETAFLQADERFIQKRITSGTTCVCALINRDQLYIAWVGDSKALLVGKRTQ
LQLVKPHKPESPDERKRIEAAGGTVLHAQGQWRVNGILNVARSIGDYCLETVIAEPDFVD
VHLNEAHDFLVLGTDGLWDHVPETFIIDTVYECLADPTTKLDDIPKLLIEAAKERDSQDN
ITAVIVLLKPRHQIER
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccgactcgatcaaggagccagcagcacctgccgcggaatgcgctcatatgttg
gaattcaaggagtttctggcctcgacagccgccaaagcatccgccaccacggaggatttg
acgcgaaattgtgtaacgcggacctgcaatgagacctacaaggtgtctgtcgaggagcgc
cacgctgagctggtggctgcaatttggcagcagctgaattccagaggctgtccggcggtc
ttccgcctgaagttgctccaccaggccacacagctgctggagaaggagatatgctacgca
aaggagtgtgaagtctctgtcgagggtcccacgcaatatgatctgctgaagctgcagaag
tttgtcagcaatcaaatggacaagctgctaataaagctaaccgacaattcggagatggaa
cggctaaagaactatgccgacgagggtgtcatctgccaaagtcccgaacattgcatgtgc
ggactggcccaaacggcgcttcacacatccgcggccgttaagaacaagccacgcaaaatg
gaagatcgtcatgtctgtttggaccgatttggtgccatctatgagctgcgcaacagggat
tgtcggttcttcggggtctttgacggacactctggttcattatccgccagttatgtcaga
agtcagttgccccaactcctggccgatcagctaaggcaagcggaccaacaaacagagacc
cagagctctgacttctatcggaatgcctttgagacggccttcctgcaggcagacgaacgc
tttatccaaaaacgcatcacaagcggaacgacctgtgtctgtgcactgatcaatagagat
caactgtacatagcctgggtgggcgactccaaggccctgctggtgggcaagcgcacacag
ctgcagctggtaaaaccgcacaaacccgagtcccccgatgagcgcaaacgcatagaggcc
gccggcggtacagtcctgcacgcccagggtcagtggcgtgtgaatggcatcttgaatgtg
gcacgatccattggcgattactgcctggagacggtcatagcagagccagatttcgtagat
gttcacctaaatgaagctcatgacttccttgtgctgggcaccgatggcctgtgggatcat
gttccggagactttcatcatcgacactgtttacgagtgtctagccgatccgacaacgaaa
ctagacgacattccgaagctactgatcgaggcggccaaggagcgggactcgcaggacaac
ataaccgctgtgatagttttgctcaaaccgcgtcatcagattgagaggtag

DBGET integrated database retrieval system