KEGG   Drosophila persimilis: Dper_GL18777Help
Entry
Dper_GL18777      CDS       T01063                                 

Definition
GL18777 gene product from transcript GL18777-RA
Orthology
K08738  
cytochrome c
Organism
dpe  Drosophila persimilis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dper_GL18777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 105 aa AA seqDB search
MGGGDADNGKKIFVQKCAQCHTVESGGKHKVGPNLSGIVGRKSGSAPGFKYTDANQKKGV
VWSDSTLDEYLKDPKKYIPGTKMVFAGLKKAEDRADLIAYLKKNK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggggggcggtgatgcagacaacggcaagaagatttttgtacagaagtgcgcccagtgc
cacaccgtcgaatcggggggcaagcacaaggttggccccaatctaagcggcattgtggga
cgcaaatccggctctgctccgggcttcaaatacacagatgctaatcaaaagaagggcgtt
gtttggagcgattcgacgctggacgagtacctcaaggatccaaagaaatacatacccggc
actaagatggttttcgcaggactcaaaaaggccgaagaccgtgccgatttgattgcatac
cttaaaaaaaataagtaa

DBGET integrated database retrieval system