KEGG   Drosophila persimilis: Dper_GL18778Help
Entry
Dper_GL18778      CDS       T01063                                 

Definition
GL18778 gene product from transcript GL18778-RA
Orthology
K08738  
cytochrome c
Organism
dpe  Drosophila persimilis
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dpe00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 116 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTRMILAGLKKPNERGDTDCLPEVCHQLRKLVTTT
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttccagctggtgatgttgagaagggcaagaagctgttcgtgcagcgttgcgca
cagtgccacaccgtggaggctggtggcaagcacaaggttggtcccaatctgcatggtctg
atcggtcgcaagactggccaggctgccggtttcgcatacacggacgccaacaaggccaag
ggaatcacctggaatgaggataccctcttcgagtacctggagaaccccaagaagtacatc
cccggcaccaggatgatcttggccggtctgaagaagcccaatgagcgcggtgatactgat
tgcctacctgaagtctgccaccaactgaggaaacttgtgacaaccacgtaa

DBGET integrated database retrieval system