KEGG   Drosophila persimilis: Dper_GL18962Help
Entry
Dper_GL18962      CDS       T01063                                 

Definition
GL18962 gene product from transcript GL18962-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dpe  Drosophila persimilis
Module
cGMP signaling
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dper_GL18962
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dper_GL18962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1002 aa AA seqDB search
MACFPRLFHHRNKNKFTPAQDENTDTILNTHDSPVQIGLYIRREEKPLYSPIVTPSASEA
KLQRLRLQPTNSSSSSSSPISFPLQTLAENGGENNTNSLQRQPKKFRSNKSKLQPSKRKE
KQDDEPQAEGDPVNGNAINVTRSNSKLKPVKERRPTALPTEAPNIEFDDVEESGAGASAD
GGACADGGDAVDGKSKLGVNENGIIDEVVTPSGTTSPATDGGNVKFFIGHTQELSTDQAD
DTLSWQSSDTNNNSNINRTLANGALPQDRPEGGGQQLLEAPPNGKSSSNVSLNYLTKCSG
DSHRRRRASTMPDINIPPAPPMPAELLVPGTPVHLRKKRSVECRQNLQTDVKLSPPEASN
NQEQIPTPSRNSDGEKSRLTESSVPKAHRVEGGLIYVRPNYPIQGDLQIESITKDKATRN
LIHMAIERNDFLNNLMDKERKEMVINAMAPASYKKNSYIIHEHEEGSEIYVSAEGHYDVI
RAGQLVGNFGPATVFGELAILYNAPRQATIKAATDARVWKIARETFRAIMQISGSREREE
NLQFLRSVPFLQELEESLLNKVVDLLQRKFYETGSCIVREGEVGNEFYIIRGGTVTIKKE
DESKEEQVVARRKRGDYFGEQALLNADVRQASVYADAPGTEVLKLDREAFISYLGTIKQL
RDKPSQRTEPHGRSSNKSMEFDNEHAQIAISELKKVATLGAGAFGRVDLVAYGQLTFALK
IIKKIEVVKQDQIEHVYNEKNVMIKCRHSPFIVQLYRTYRNDKYVYFLMEACMGGDVWTV
MSKRQYFDEKTAKFIAGCVVEAFDFLHSHNFIYRDLKPENLMLGTDGYCKLVDFGFAKYV
RPNEKTNTFAGTPEYVAPEIILDRGHDRSVDYWALGILIYELLVGKTPFRGVNQIKIYQQ
ILSGIDVIHMPTRIPKSAQHLVRHLCKQLPAERLGYQRKGISDIKRHSWFESLDWQRLKD
KQLPSPIKRPLKSWTDLQYFGPSGVENDYEPPEELSGWDVDF
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctttcctcgattgttccatcatcgcaacaaaaacaagttcactcccgcccaa
gacgagaacaccgacacgatactcaacacgcacgatagtccggtgcaaatcggcttgtac
attcggcgcgaggaaaagcccctttactcgcccatcgttacgcccagtgccagtgaggcc
aagctgcaacggctaagactgcagcccacgaactcctcctcctcatcctcctcgcccatc
agcttcccgctgcagactttggccgaaaacggcggcgaaaacaatacaaacagcctgcag
aggcagccaaagaagtttcgctccaacaagagcaaactgcagccgagcaaaaggaaggag
aagcaagatgacgagccgcaggcggagggagaccccgtcaatggcaatgcaattaatgtc
acacgttcaaattccaaattaaagccagtcaaagagcggcgacccacagccctgcccaca
gaggcgcccaatatcgagtttgatgacgtggaggagtcgggggctggggccagcgcagac
ggcggtgcctgtgccgatggaggcgatgctgtcgacggcaagtcaaagctcggagtgaat
gagaatggaataattgatgaggtcgtcacgccgtcgggcaccacatctcctgcaacggat
gggggaaatgtaaagtttttcattggtcatacacaggaacttagcacagaccaagcagat
gataccttgtcctggcagagcagcgacaccaacaacaacagcaacataaaccgcacgttg
gcaaatggggcactgccacaagatcggccagaagggggagggcagcagctgctcgaagct
ccgcccaacggcaagagtagcagcaatgtgtcactcaattatcttacaaagtgcagtggc
gacagtcaccgtcgacgacgtgcgtctaccatgccagatattaacataccgcctgcgccg
ccgatgcctgccgagcttctggtccccggaacgcctgtacacttgcggaagaaacggagc
gtcgaatgccggcagaacctacaaacagacgtcaaactaagtcctccggaggcttcgaat
aatcaagaacaaataccaacaccttcgcggaacagcgatggagagaagagccgactcacc
gaatcatcggttccaaaggctcatcgtgtggaaggtggactgatctatgtccgaccgaat
taccccattcaaggcgaccttcaaatcgaatcaattacaaaagacaaagccacacgcaat
ctcatacacatggccattgaacgcaatgatttccttaataacctaatggacaaagagcgg
aaggagatggttatcaatgcaatggcgccggctagctacaaaaagaatagttacatcata
cacgagcacgaggagggctccgagatatatgtatccgccgagggccactacgatgtcata
cgcgccggacagcttgtgggcaactttggaccggcaaccgtattcggggagctggcaata
ctctataacgcccccaggcaggccaccattaaggctgccactgatgcccgagtttggaaa
atagcacgtgagacctttcgggccatcatgcaaatctccggttccagggaacgcgaagaa
aaccttcagttcctccggtcggttccatttctgcaagagctcgaagaaagcttgctcaac
aaagttgttgacctccttcaaaggaaattctatgagactggcagctgcattgtacgtgaa
ggcgaggtgggaaacgagttctatatcattcgaggcggaaccgttaccataaaaaaggag
gacgagtcaaaagaggagcaagttgtggcaaggcgcaagcgaggcgactactttggcgaa
caggcgcttctgaatgcggatgtgcggcaggccagtgtctatgcagatgcaccaggcact
gaggtcctaaagttggatagagaagcgtttataagctatttgggaactatcaagcaactt
cgtgacaagcctagtcagcggaccgagccccatggtcgatccagtaacaaaagcatggag
tttgacaacgagcacgcccagatagccatctccgaactgaagaaggtggccaccttgggt
gctggtgcttttggacgtgtggatctggtggcctatggccagctaacgtttgccctgaaa
ataatcaagaagatcgaggtggtcaagcaggatcagattgagcacgtctacaatgagaag
aacgtgatgatcaagtgccggcattcgccgttcatagtgcaactctaccgaacgtaccgg
aacgacaaatacgtctactttctaatggaggcctgcatgggcggcgatgtgtggacagtt
atgtcgaagcggcagtacttcgatgagaagaccgccaaatttatagcgggctgtgtcgtc
gaagccttcgactttctgcactcgcacaactttatttacagggacctcaagcctgagaac
ctcatgctgggcacagacggctactgcaaactggtggactttgggtttgccaaatatgtt
cgaccgaatgagaagacaaacacctttgccggtacgccggaatatgtggcacccgagatt
attctggaccgtgggcacgatcggtccgtcgactactgggcgttgggcattctaatctac
gaactgctggttggcaaaacgccctttagaggcgtgaaccaaataaagatttatcagcaa
atcctcagcggcatcgatgtcatacacatgcccactcgaatccccaaatccgcgcagcac
ctggtgcgtcatctgtgcaaacagctgcctgccgaacgcttgggataccagcgcaagggg
atttccgatatcaagcgacacagttggttcgagagtctggattggcagcgactgaaagat
aaacaattgccttccccaataaagcgacccctcaaaagttggaccgacctgcaatacttt
gggccgtccggcgtggaaaacgattatgagccaccggaagagttgagcgggtgggacgtg
gacttttag

DBGET integrated database retrieval system