KEGG   Drosophila persimilis: Dper_GL18973Help
Entry
Dper_GL18973      CDS       T01063                                 

Definition
GL18973 gene product from transcript GL18973-RA
Orthology
K16172  
insulin receptor substrate 1
Organism
dpe  Drosophila persimilis
Pathway
FoxO signaling pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dpe04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dpe04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 736 aa AA seqDB search
MASTSDDGLVLSGYQKKLKTMKKKFFVLYEETNNAAARLEYYDTEKKFMQRAEPKRVIYL
SSCFNINPRFDTKHRFVIVLSSREGGFGIVLETENDLRKWLEKLLFLQRHQANINGLMQS
TYEHVWEVCIQKKGMSEKVGITGTYHCCLTSKSLTFVCIGPEKTANGDARVSSIEILLTT
IRRCGHASPQCIFYMELGRQSVLGCGELWMETDNAAVATNMHNIILSAMSAKTETNMNFL
NVYQGRPEISHEPMRKRSSSANESSKPMNVIQTRQSAVELRNSSFLHNNTYGRERCDSLP
TRNRTISDCSNQINLGSSHGFRSNTISGNRPHSTNKPNNSPPFNTPLRCSESEESSISVD
EADDNGSFTPYRRNTRSSKGAIPEENIDDFASAELSSTTVKNERVDNYIPMTPIKPISDT
VHVNEMVESNHMLLKSAGAENLHFNFPEHISEKLVKDLDGDSDSQCDRPIRAYSIGNKVE
YSKLKRIGYINETGKNSHRVRAYSVGSKSKIPRCDLQRIVLVEKDKNQSGTNGSHNNIFT
GDSNSNEVIRSSTIREKKSTSAPLLSLKHPINTDRMSDLMEIDFSQTAKWENXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXTTGQET
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaacatcggatgatggattagtcctaagcggctaccaaaaaaaactgaaaaca
atgaaaaagaaattttttgttctgtatgaagaaacgaacaatgcagccgcacgtttagaa
tattacgatacagaaaaaaaatttatgcaaagagcagaaccaaaaagagttatttattta
agtagctgctttaatataaatcctcgttttgatacaaaacacaggtttgttattgtatta
tcctcaagagaaggtggatttggaattgtgctcgaaactgaaaatgatttacgcaaatgg
ttagaaaaattattattcttacaacggcatcaggcaaatataaatggtctaatgcaatca
acatatgaacatgtgtgggaagtttgtattcaaaaaaaaggaatgtctgaaaaagttgga
attactggaacctatcactgctgcctaacctcaaaatccctaacattcgtatgcataggt
ccggaaaaaacagcaaatggcgatgcgcgagtctctagtattgagattcttttgacaaca
atacgtcggtgcggccatgcatctcctcaatgcattttctacatggaacttggccgtcag
agtgttttaggctgtggggaattatggatggaaacagataatgctgctgtagctacaaat
atgcataatataatattgagcgctatgtcagccaaaactgagactaacatgaacttttta
aatgtgtatcaaggaagacctgaaattagtcatgaaccaatgagaaaacgttcatcatcg
gcaaacgaatcctccaaaccaatgaacgttattcaaactcgtcaaagcgctgtcgaattg
cgaaatagcagtttcttacataataacacttatggaagagaaaggtgtgatagtttgcca
acaagaaatcgaactataagcgactgcagcaatcaaataaaccttggatcaagtcacggg
ttccgatctaacacgatttctgggaaccgtccacactcaactaacaagcctaataatagt
ccaccgtttaacacacctttacgatgctcggaatctgaagaatcatcaattagtgtcgac
gaagccgatgataacggaagttttacgccttatcgacgaaacactaggtcttccaaagga
gctattcccgaagaaaatattgacgattttgcaagtgctgagctcagttcaaccactgta
aaaaatgagagagttgacaactatattccgatgacgcctattaagcccataagtgatact
gttcatgttaatgaaatggtggagtctaatcatatgttgttgaaaagtgcaggcgctgaa
aatttacattttaactttcctgagcatatatccgaaaaacttgttaaagatctggatgga
gattcggatagtcagtgtgatcgtcctattcgtgcttactcaatagggaataaagttgag
tactcaaaactaaaacgcattggatacataaatgaaactggaaagaactcgcatcgtgta
cgagcgtattccgttgggtcaaagtccaagatacctcgatgtgatttgcaacgtattgtt
cttgtggaaaaggataaaaaccaatctggaacgaacggaagccataataacatttttaca
ggcgattctaattcaaatgaagtcattcgttctagtacaatccgagaaaaaaaatccaca
agtgctcctctattaagccttaaacatccaataaacactgatcgtatgagtgatttgatg
gaaattgacttttcacaaacagcgaaatgggaaaacnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnngacgacggggcaagagacctaa

DBGET integrated database retrieval system