KEGG   Drosophila persimilis: Dper_GL18977Help
Entry
Dper_GL18977      CDS       T01063                                 

Definition
GL18977 gene product from transcript GL18977-RA
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
dpe  Drosophila persimilis
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Hippo signaling pathway - fly
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dper_GL18977
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dper_GL18977
   04391 Hippo signaling pathway -fly
    Dper_GL18977
   04068 FoxO signaling pathway
    Dper_GL18977
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dper_GL18977
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dper_GL18977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 371 aa AA seqDB search
MAAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTVTEQNVAIKKLSRPFQN
VTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEDFQDVYLVMELMDANLCQVIQMDL
DHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMT
PYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGT
PSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDALFPNDNNQNSRRKAADARDLLSKML
VIDPEQRISVDKALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMD
YEAHNTNNRTR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcaacaccaacactataccgtagaagtaggggataccaattttactatccat
agtcgctacattaacctaaggcccataggatctggtgcccaaggaatagtatgtgctgct
tacgacactgtcactgagcaaaacgtggccatcaagaagttatcgcgaccattccaaaat
gtaacccatgccaagagagcatatagagaattcaagctaatgaagcttgtaaaccataaa
aacattattggcttgcttaatgcttttactccgcaacgaaatttagaggattttcaagac
gtttaccttgtcatggagctaatggacgctaatctctgccaagtcattcaaatggacttg
gatcatgacagaatgtcatatttgctatatcaaatgttgtgcggaataaaacatttgcat
tcagctggaattatacatagagacttaaaaccatccaatatagtggtgaaggccgactgt
actctaaaaattttagactttggacttgcacgcactgcaggaactaccttcatgatgact
ccgtatgttgtaacacgctactacagggcaccagaagtcattttgggaatgggctatact
gagaacgttgatatatggtccgtcgggtgcattatgggtgaaatgatacgaggtggggta
ctctttcctggaacagatcatatagatcagtggaataaaattattgagcaattaggcaca
ccatctccatcatttatgcaacggttacaaccaactgtacgaaattatgtggaaaatcgt
cctcggtacactggatattcatttgatagactctttcccgatgcattatttccaaatgat
aataatcagaacagtcgaaggaaagctgcagacgccagagatctccttagtaaaatgctt
gtaattgacccagaacagcggatatctgtagacaaggcattgaaacatgaatatataaat
gtctggtacgatgctgaggaagtagacgctcctgctccagagccgtatgatcatagcgtt
gatgaaagagaacatactgtggaacaatggaaggagttaatttatgaagaagttatggac
tacgaggcacataacactaataatagaacacggtag

DBGET integrated database retrieval system