KEGG   Drosophila persimilis: Dper_GL18982Help
Entry
Dper_GL18982      CDS       T01063                                 

Definition
GL18982 gene product from transcript GL18982-RA
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.4.19.12]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dper_GL18982
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C67
   Dper_GL18982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 551 aa AA seqDB search
MILNKNKTSVEGNSNDEGQPKSSNPLSIAVKDESLGHTISDYQRLIEIPGTELAIGSLVE
VSDSGVCGDVYGVIRWIGIPPGISKNVLVGIELEDEPSLKNIPLSDGSYNGLRFFTCHQG
RAIFVTSDRCKTDRRFTDKDSYHVGNKITNNQEINFGAVACPSISGSVPPLRIHSSDELQ
KICGKFKGIQGHHNSCYLDATLFSMFTFTSVFDSILYRSPGPKDIRNYRDVQKVLRDEIV
NPLRKQLFVRSDSVMKLRELLDQLSSVSGLTCEEKDPEEFLNSLLSQIMRVEPFLKLSSG
QDSYFYQLFVDKDEKLTLPTVQQLFEQSFHSSNIKLKEVPSCFIIQMPRFGKSYKMYPRI
LPSQVLDVTDIIENSPRQCFLCGKLAEYECNECFGSLQVGSGLECTAFCQQCLVTFHMHA
KRNNHVPTKICIPKDFRIMADHMVVPRVYMELFSVVCIETSHYVAFVKSGSGPDAPWCFF
DSMADRKGEQNGYNIPEMTCVPELTQWLSDEGARSINETSPNDKVLPDHAKRIFCDAYMC
LYQSTDTMMYH
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaataaaaataaaacatctgtggagggcaacagtaacgacgagggtcagccg
aaatcttcgaacccactatcgatagcagtcaaagatgaatctttgggtcacacaatttca
gattatcaacgcctgattgaaataccaggaacagagcttgcaattggctccctcgtggaa
gtatctgattctggcgtgtgtggagatgtgtatggtgtaataagatggattggtatacct
ccaggaatttctaaaaacgtacttgttggaatagagcttgaagacgaaccttccttgaag
aacattccattgtcagatggaagttacaatggccttcgcttttttacgtgtcaccaaggt
cgggctatttttgtaacgtccgacaggtgcaaaactgatcgccgattcaccgataaagac
agctaccatgtaggaaacaagatcactaacaatcaggagataaacttcggtgccgtcgcg
tgcccttctatttctggttcagtaccgccactgcgaatacatagttcggatgaactccag
aaaatttgtggaaaattcaagggaatacaaggacatcataactcttgctatcttgatgcg
acactattttcgatgttcacttttactagtgtgtttgattctatactgtaccgatctcca
ggacccaaagatattcggaattacagagatgttcaaaaggttttgcgggatgaaattgtt
aatccattgagaaaacaattatttgtgcgatctgacagcgttatgaagctgcgtgaacta
ttagaccaactcagttctgtaagtggtctcacatgcgaggaaaaagatcctgaagagttc
ctgaacagtttactatcacaaattatgcgcgtcgaaccattcttaaaacttagctccgga
caagactcatatttttatcaactgtttgtggataaagatgaaaaactaacattaccaact
gtccagcaactttttgaacaaagctttcattcgtcgaatatcaaactaaaggaggttccc
tcttgttttattattcagatgcctcgttttggaaaaagttacaaaatgtatccaagaatt
ttaccctcgcaagttctagatgtgacagacataattgaaaactctcctcgacagtgcttt
ctgtgtggaaaactagctgaatatgaatgtaatgaatgttttggaagtctacaagtcggc
tcaggtcttgagtgtacagccttttgtcaacaatgccttgttacatttcatatgcatgca
aaaaggaataatcacgtgcctacaaaaatatgtattcccaaggacttcagaattatggct
gatcatatggtagtaccacgcgtgtacatggaactattttcagttgtttgtatagaaaca
tctcattatgtagcgtttgtaaaatcaggttctgggccagatgcaccatggtgttttttc
gattcaatggctgatagaaagggtgaacagaatggatataacataccggaaatgacatgt
gttcccgaattaacacagtggctttccgatgaaggtgcgcgctctattaatgaaacatca
cctaatgataaagttctacctgatcacgccaagcgtattttttgcgatgcctatatgtgt
ctgtatcaaagcacagacactatgatgtaccattaa

DBGET integrated database retrieval system