KEGG   Drosophila persimilis: Dper_GL19091Help
Entry
Dper_GL19091      CDS       T01063                                 

Definition
GL19091 gene product from transcript GL19091-RA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dpe  Drosophila persimilis
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dpe00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dpe00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dpe00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dpe00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dpe00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dpe04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 672 aa AA seqDB search
MSCRCTRKLTMAMSGCVIILVIALTVGLCVGLGGSESEGVREDPPKFTIDHESNSFVLNG
EPFRYVAGSFHYFRAVPEAWRSRLRTMRASGLNAVDTYVEWSLHNPHDGVYNWEGIADVV
KFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFKKYPSIKMRTSDSNYMAEVGKWYAE
LMPRLQHLLIGNGGKIIMVQVENEYGDYECDKDYLNWLRDETEKYVNRNALLFTTDIPNE
RMSCGKIDNVFATTDFGIDRIHEIDDIWTMLRKLQPTGPLVNSEFYPGWLTHWQEMNQRR
DGQVVADALKTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMD
EAGGVTSKYNLVKQVIGEFLPLPEITLNPAKRLAYGKVEVTPSLALLSAEGRSALAKGDP
VESTKPKSFEELDLYSGLVLYETELPSIDLDPALLKVDQINDRAHVFVDQELVGTLSRDA
QIYSLPLSKGWGSTLQLLVENQGRVNFYISNDTKGIFGEVSLQLHNGGYLPLENWKSTAF
PLEEVTVEAWRKKSGERALDAFLARQRILRNGPILYTGSLMVEEVGDTYLNMAGWGKGVA
YVNGFNLGRYWPVAGPQVTLYVPNEILKVGNNSLVILEYQRTNKTANGEDLPAVQFDAVA
QLDGQSGDVPLK
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtcgttgcactcgaaagctgacgatggccatgagcggctgtgtgattattttg
gtgatcgccctcaccgtcggtctttgtgtgggccttggcggcagcgagagcgagggagtc
cgcgaggatccgcccaaattcacaatcgaccatgagtccaacagctttgtgctgaatggc
gaaccattccgatatgtcgctggatcgttccattacttccgggcggtgcccgaggcctgg
aggagtcgattgcggactatgagagcatctggtctgaatgcagtggatacctatgtggaa
tggtcgctccacaatccccacgatggggtctataactgggaaggcattgccgatgttgtg
aaatttctagagattgcccaagaggaagacttttacataatactgcgtcctggtccctat
atctgtgcagagcgcgataatggtggccttccccactggctatttaagaaatatcccagc
atcaaaatgagaactagtgatagcaattacatggccgaagtcggtaaatggtatgcagaa
ttgatgccacgcctgcagcacttgctgatcggcaacggtggcaagatcattatggtgcag
gttgagaacgagtacggcgactacgaatgcgataaggactacctgaattggctgcgtgac
gagacggagaagtatgtgaatcggaatgccctgctcttcacaacggacatacccaacgaa
cgcatgagctgcggcaagatcgataatgtttttgccaccacggactttggcattgatcga
attcacgagattgacgacatctggacaatgcttcgtaaactgcagcccacgggaccactg
gtcaattcggagttctatccaggatggttgacccactggcaggagatgaatcagcgacgc
gatggtcaagtggtggccgatgccttgaagaccattctgagctacaatgccagcgtcaat
ctgtacatgttctttggcggcaccaacttcggattcactgccggagctaactacaatctc
gatggaggtattggctatgctgcagacatcaccagctatgactacgatgctgtgatggac
gaggctggcggcgtgactagcaaatacaacctggttaagcaggtgattggtgaatttctg
ccactgcccgagatcacgctcaatcccgccaagcgtttggcctacggcaaggtggaagtg
acgccctcgctggcccttctctctgcagaaggacgatctgccctggccaagggcgaccct
gtggagtcaacaaaaccaaaatcctttgaggaactcgatctgtactccggtctggtgctg
tacgagacagagctgcccagcattgacctcgatccggctctcctgaaggtggaccagatc
aacgatcgtgcccatgtctttgtggatcaagagctggtaggaacactgtccagggacgcg
caaatatattccctgccattgagcaaaggatggggcagcacgctccagctactggtggag
aatcagggacgcgtcaacttctacatctccaacgacacaaagggtattttcggtgaagtg
agtctccagctgcacaatggcggctatctcccgctagagaactggaagagcactgcattt
cccctcgaagaggtgaccgtagaggcctggcggaagaaaagcggagaacgagcactggat
gcattcttggccaggcaacgaatcctgcgtaatggacccatcctctatacgggcagcctc
atggtggaggaggtcggagacacctacctaaacatggctggctggggcaagggcgtggcc
tatgtgaatggcttcaatctgggccggtactggcccgtggcgggtccccaggtcacactc
tacgtacccaacgagatcctcaaggtgggaaacaactctttggtgattctggagtatcag
cggacgaacaagaccgcaaatggtgaggatctacccgctgtgcaatttgatgcggttgct
caattggatggacagtcgggagatgtgcctctcaagtga

DBGET integrated database retrieval system