KEGG   Drosophila persimilis: Dper_GL19091Help
Entry
Dper_GL19091      CDS       T01063                                 

Definition
GL19091 gene product from transcript GL19091-RA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dpe  Drosophila persimilis
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dper_GL19091
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dper_GL19091
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dper_GL19091
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dper_GL19091
   00511 Other glycan degradation
    Dper_GL19091
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dper_GL19091
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dper_GL19091
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dper_GL19091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 672 aa AA seqDB search
MSCRCTRKLTMAMSGCVIILVIALTVGLCVGLGGSESEGVREDPPKFTIDHESNSFVLNG
EPFRYVAGSFHYFRAVPEAWRSRLRTMRASGLNAVDTYVEWSLHNPHDGVYNWEGIADVV
KFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFKKYPSIKMRTSDSNYMAEVGKWYAE
LMPRLQHLLIGNGGKIIMVQVENEYGDYECDKDYLNWLRDETEKYVNRNALLFTTDIPNE
RMSCGKIDNVFATTDFGIDRIHEIDDIWTMLRKLQPTGPLVNSEFYPGWLTHWQEMNQRR
DGQVVADALKTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMD
EAGGVTSKYNLVKQVIGEFLPLPEITLNPAKRLAYGKVEVTPSLALLSAEGRSALAKGDP
VESTKPKSFEELDLYSGLVLYETELPSIDLDPALLKVDQINDRAHVFVDQELVGTLSRDA
QIYSLPLSKGWGSTLQLLVENQGRVNFYISNDTKGIFGEVSLQLHNGGYLPLENWKSTAF
PLEEVTVEAWRKKSGERALDAFLARQRILRNGPILYTGSLMVEEVGDTYLNMAGWGKGVA
YVNGFNLGRYWPVAGPQVTLYVPNEILKVGNNSLVILEYQRTNKTANGEDLPAVQFDAVA
QLDGQSGDVPLK
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtcgttgcactcgaaagctgacgatggccatgagcggctgtgtgattattttg
gtgatcgccctcaccgtcggtctttgtgtgggccttggcggcagcgagagcgagggagtc
cgcgaggatccgcccaaattcacaatcgaccatgagtccaacagctttgtgctgaatggc
gaaccattccgatatgtcgctggatcgttccattacttccgggcggtgcccgaggcctgg
aggagtcgattgcggactatgagagcatctggtctgaatgcagtggatacctatgtggaa
tggtcgctccacaatccccacgatggggtctataactgggaaggcattgccgatgttgtg
aaatttctagagattgcccaagaggaagacttttacataatactgcgtcctggtccctat
atctgtgcagagcgcgataatggtggccttccccactggctatttaagaaatatcccagc
atcaaaatgagaactagtgatagcaattacatggccgaagtcggtaaatggtatgcagaa
ttgatgccacgcctgcagcacttgctgatcggcaacggtggcaagatcattatggtgcag
gttgagaacgagtacggcgactacgaatgcgataaggactacctgaattggctgcgtgac
gagacggagaagtatgtgaatcggaatgccctgctcttcacaacggacatacccaacgaa
cgcatgagctgcggcaagatcgataatgtttttgccaccacggactttggcattgatcga
attcacgagattgacgacatctggacaatgcttcgtaaactgcagcccacgggaccactg
gtcaattcggagttctatccaggatggttgacccactggcaggagatgaatcagcgacgc
gatggtcaagtggtggccgatgccttgaagaccattctgagctacaatgccagcgtcaat
ctgtacatgttctttggcggcaccaacttcggattcactgccggagctaactacaatctc
gatggaggtattggctatgctgcagacatcaccagctatgactacgatgctgtgatggac
gaggctggcggcgtgactagcaaatacaacctggttaagcaggtgattggtgaatttctg
ccactgcccgagatcacgctcaatcccgccaagcgtttggcctacggcaaggtggaagtg
acgccctcgctggcccttctctctgcagaaggacgatctgccctggccaagggcgaccct
gtggagtcaacaaaaccaaaatcctttgaggaactcgatctgtactccggtctggtgctg
tacgagacagagctgcccagcattgacctcgatccggctctcctgaaggtggaccagatc
aacgatcgtgcccatgtctttgtggatcaagagctggtaggaacactgtccagggacgcg
caaatatattccctgccattgagcaaaggatggggcagcacgctccagctactggtggag
aatcagggacgcgtcaacttctacatctccaacgacacaaagggtattttcggtgaagtg
agtctccagctgcacaatggcggctatctcccgctagagaactggaagagcactgcattt
cccctcgaagaggtgaccgtagaggcctggcggaagaaaagcggagaacgagcactggat
gcattcttggccaggcaacgaatcctgcgtaatggacccatcctctatacgggcagcctc
atggtggaggaggtcggagacacctacctaaacatggctggctggggcaagggcgtggcc
tatgtgaatggcttcaatctgggccggtactggcccgtggcgggtccccaggtcacactc
tacgtacccaacgagatcctcaaggtgggaaacaactctttggtgattctggagtatcag
cggacgaacaagaccgcaaatggtgaggatctacccgctgtgcaatttgatgcggttgct
caattggatggacagtcgggagatgtgcctctcaagtga

DBGET integrated database retrieval system