KEGG   Drosophila persimilis: Dper_GL19093Help
Entry
Dper_GL19093      CDS       T01063                                 

Definition
(RefSeq) GL19093 gene product from transcript GL19093-RA
  KO
K05759  
profilin
Organism
dpe  Drosophila persimilis
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dper_GL19093
Membrane trafficking [BR:dpe04131]
 Others
  Actin-binding proteins
   Others
    Dper_GL19093
Cytoskeleton proteins [BR:dpe04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     Dper_GL19093
Exosome [BR:dpe04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dper_GL19093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 130 aa AA seqDB search
MSWQDYVDNQLLASQCVTKGVHCRTRWQHLGRSLLALRFKPITKEELAKLISGFDQQDIL
TSNGVTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEK
LGDYLITCGY
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgtggacaaccaactgctcgcctcgcagtgcgtgaccaagggc
gtgcattgccggacacgatggcaacatctggggcgcagtctgctggctttgaggtttaag
cctattacaaaggaggaactggccaaattgattagcggcttcgaccagcaggatatcctt
accagcaacggtgttacattagccggccaacggtacatttacctctcaggcacagatcgt
gtggtgcgcgccaagcttgggcgaagtggagtccactgcatgaagacaacacaagccgtc
atcgtttccatctacgaggatcccgtacagccccagcaggccgcttccgttgtagagaaa
ctcggagactatctgattacttgcgggtactag

DBGET integrated database retrieval system