KEGG   Drosophila persimilis: Dper_GL19416Help
Entry
Dper_GL19416      CDS       T01063                                 

Definition
GL19416 gene product from transcript GL19416-RA
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 227 aa AA seqDB search
MSTWTPLESNPEVLTKYIHKLGVSPAWSVNDVIGLDEDMLEFIPRPVKAFILLFPCSEAY
EKHRAEEHERIKDVKEQHPDDLFYMRQFTHNACGTVALIHSVANNKEVDVTGGVLKKFLE
KTAALSPEERGSALEQDTEFTADHQALAQEGQTNADEHESVIHHFIALVNKDGTLYELDG
RKSFPIKHGKTTEETFVSDAAKVCKEFMARDPTEVRFTVLALTAAQD
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctggacgccacttgaatccaaccccgaggtgctgaccaagtacatacacaag
ctaggcgtgtcgcctgcctggtcggtgaatgacgtcattggtctggacgaagatatgctc
gagtttattccccgtccggtgaaggctttcatattgctctttccatgcagcgaggcttat
gagaaacatcgtgctgaggagcatgagcgcatcaaggatgtgaaggagcagcatcccgac
gatctgttctacatgcgccaattcactcacaatgcttgcggcactgtggccctcatccat
agcgtggccaataacaaggaggtggatgtaactgggggagttctgaagaagttcctggag
aaaaccgccgctttgtcgccagaggagcgtggctctgctttggagcaagataccgagttt
acagccgaccatcaggctttggctcaagagggccagaccaatgccgacgagcatgagagt
gtgatccatcattttattgctttggtgaacaaagatggcaccctctacgagctcgatgga
cgcaaatcgtttcccatcaagcatggcaagaccacagaggagacctttgtgagcgatgcg
gccaaggtgtgcaaagagtttatggcccgtgatcccaccgaagtacgtttcacagtcttg
gccttgactgctgcgcaggattag

DBGET integrated database retrieval system