KEGG   Drosophila persimilis: Dper_GL19554Help
Entry
Dper_GL19554      CDS       T01063                                 

Definition
GL19554 gene product from transcript GL19554-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dpe  Drosophila persimilis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dpe01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dpe00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dpe04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 282 aa AA seqDB search
MRLRLLLAVFVCFADAYRPVVILHGILSGADSMDFLVREIEELHRGTIVYNCDKFSGWYS
LENAWRQVEQIRDYLSDVGKKHPEGINVLGYSQGGLLARAAIQSLPDHNVKTFISLSSPQ
AGQYGTSFLHLIFPDLAAKTAFELFYTTVGQHTSVGGYWNDPHKQSLYLKYSEFLPLINN
EKQSSNSTSFKMGMVRLSKLVMVGGPNDDVITPWQSSHFAYYDEDLDVIPFNKRKLFTDD
LIGTRTLQEAGKLIIIVKPHVHHLAWHTNRAVIHQVILPYLD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaggctaaggctcttgctggctgtgttcgtctgctttgctgatgcatacaggccggtt
gtgatactccatggaatcctgtcgggcgcggattcaatggactttttggtgcgggaaatc
gaagagctccatcggggcacaatcgtctacaactgcgacaaattcagcgggtggtacagc
ctggagaatgcctggcggcaggtcgagcagattcgggattatttgagcgatgttggtaaa
aagcacccggaaggaatcaatgtgttgggctactcccagggcggactcttggcccgtgcg
gctatccaaagtctgcccgatcacaatgtaaagaccttcatttccctatcttcgcctcaa
gcgggtcaatacggaaccagcttcctgcatctgatatttccggatctggcggcgaagacc
gcctttgagctattctacacaacggtagggcagcacacatcggtgggcgggtactggaac
gacccgcataaacagtcactgtatttgaaatatagcgaattcctgccgctgatcaacaat
gagaagcagtcctccaactccacctccttcaaaatgggcatggtgcgtctcagcaagctg
gtcatggtcggcggccccaacgacgatgtgataacgccctggcaatccagccactttgca
tactacgacgaggacttggacgtgattccgttcaacaagcggaagctcttcactgacgac
ttgatcggcactaggacgctccaagaggccgggaaacttatcatcatagtcaaaccccat
gtccatcatttggcatggcacaccaacagagccgtaatacatcaagttatcttgccatac
ctggactga

DBGET integrated database retrieval system