KEGG   Drosophila persimilis: Dper_GL19554Help
Entry
Dper_GL19554      CDS       T01063                                 

Definition
GL19554 gene product from transcript GL19554-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dpe  Drosophila persimilis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dper_GL19554
  Lipid metabolism
   00062 Fatty acid elongation
    Dper_GL19554
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dper_GL19554
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dper_GL19554
Lipid biosynthesis proteins [BR:dpe01004]
 Fatty acid synthase
  Component type
   Dper_GL19554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 282 aa AA seqDB search
MRLRLLLAVFVCFADAYRPVVILHGILSGADSMDFLVREIEELHRGTIVYNCDKFSGWYS
LENAWRQVEQIRDYLSDVGKKHPEGINVLGYSQGGLLARAAIQSLPDHNVKTFISLSSPQ
AGQYGTSFLHLIFPDLAAKTAFELFYTTVGQHTSVGGYWNDPHKQSLYLKYSEFLPLINN
EKQSSNSTSFKMGMVRLSKLVMVGGPNDDVITPWQSSHFAYYDEDLDVIPFNKRKLFTDD
LIGTRTLQEAGKLIIIVKPHVHHLAWHTNRAVIHQVILPYLD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaggctaaggctcttgctggctgtgttcgtctgctttgctgatgcatacaggccggtt
gtgatactccatggaatcctgtcgggcgcggattcaatggactttttggtgcgggaaatc
gaagagctccatcggggcacaatcgtctacaactgcgacaaattcagcgggtggtacagc
ctggagaatgcctggcggcaggtcgagcagattcgggattatttgagcgatgttggtaaa
aagcacccggaaggaatcaatgtgttgggctactcccagggcggactcttggcccgtgcg
gctatccaaagtctgcccgatcacaatgtaaagaccttcatttccctatcttcgcctcaa
gcgggtcaatacggaaccagcttcctgcatctgatatttccggatctggcggcgaagacc
gcctttgagctattctacacaacggtagggcagcacacatcggtgggcgggtactggaac
gacccgcataaacagtcactgtatttgaaatatagcgaattcctgccgctgatcaacaat
gagaagcagtcctccaactccacctccttcaaaatgggcatggtgcgtctcagcaagctg
gtcatggtcggcggccccaacgacgatgtgataacgccctggcaatccagccactttgca
tactacgacgaggacttggacgtgattccgttcaacaagcggaagctcttcactgacgac
ttgatcggcactaggacgctccaagaggccgggaaacttatcatcatagtcaaaccccat
gtccatcatttggcatggcacaccaacagagccgtaatacatcaagttatcttgccatac
ctggactga

DBGET integrated database retrieval system