KEGG   Drosophila persimilis: Dper_GL19582Help
Entry
Dper_GL19582      CDS       T01063                                 

Definition
(RefSeq) GL19582 gene product from transcript GL19582-RA
  KO
K10739  
replication factor A2
Organism
dpe  Drosophila persimilis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dper_GL19582
   03420 Nucleotide excision repair
    Dper_GL19582
   03430 Mismatch repair
    Dper_GL19582
   03440 Homologous recombination
    Dper_GL19582
   03460 Fanconi anemia pathway
    Dper_GL19582
DNA replication proteins [BR:dpe03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dper_GL19582
DNA repair and recombination proteins [BR:dpe03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dper_GL19582
   MMR (mismatch exicision repair)
     Dper_GL19582
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dper_GL19582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 237 aa AA seqDB search
MNDSFGDFNATQTAPAGAASNQKGEGIVPLFIKQIVDAPEGNIELFGMQFGMACLVAIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLNNYVKVYGTTRSQAGQKSLMV
FKLLPVLDPNEVCTHLLEALNARYKAEDYQNKGGSSAMVPDFTASQSTAIVNGLDPKQQA
VFQAIKSNMSEEGINRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcgtttggtgatttcaatgccacacagacggcaccggcgggcgccgccagc
aaccaaaaaggagagggaattgtgcctttgtttataaagcagattgtggatgcgcccgaa
gggaatattgagctgttcggcatgcaatttggcatggcgtgtctggtggcaatcgttcgg
aatgtggagacctcttccaccaagataacctatacgctggaggaccacagtggtcggatc
gatgcccactactggctggaggagggcgacgccctcaaggcaccggaagtgatgctaaac
aactacgtcaaggtctatggcaccacacgctcgcaggcgggccagaaatcgctgatggta
ttcaagctgctgcccgtcctggatcccaatgaggtgtgcacccacctacttgaggctctg
aatgcccgctacaaggcggaggattaccagaacaagggcggttcgtctgccatggtccct
gatttcaccgcctctcagagcacggctattgtgaatgggctggatcccaagcagcaggcg
gtgttccaggccatcaagagcaacatgtccgaggagggaataaatcgaaaggagctgaag
gccaagttttcgcacatcagtgattccgaattgaccaacattttggactttatgatttcg
gagggccatatctactcgagcatagatgctgatcattttatttgcaccatgtaa

DBGET integrated database retrieval system