KEGG   Drosophila persimilis: Dper_GL19582Help
Entry
Dper_GL19582      CDS       T01063                                 

Definition
GL19582 gene product from transcript GL19582-RA
Orthology
K10739  
replication factor A2
Organism
dpe  Drosophila persimilis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:dpe03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dpe03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:dpe03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dpe03440]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:dpe03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 237 aa AA seqDB search
MNDSFGDFNATQTAPAGAASNQKGEGIVPLFIKQIVDAPEGNIELFGMQFGMACLVAIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLNNYVKVYGTTRSQAGQKSLMV
FKLLPVLDPNEVCTHLLEALNARYKAEDYQNKGGSSAMVPDFTASQSTAIVNGLDPKQQA
VFQAIKSNMSEEGINRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcgtttggtgatttcaatgccacacagacggcaccggcgggcgccgccagc
aaccaaaaaggagagggaattgtgcctttgtttataaagcagattgtggatgcgcccgaa
gggaatattgagctgttcggcatgcaatttggcatggcgtgtctggtggcaatcgttcgg
aatgtggagacctcttccaccaagataacctatacgctggaggaccacagtggtcggatc
gatgcccactactggctggaggagggcgacgccctcaaggcaccggaagtgatgctaaac
aactacgtcaaggtctatggcaccacacgctcgcaggcgggccagaaatcgctgatggta
ttcaagctgctgcccgtcctggatcccaatgaggtgtgcacccacctacttgaggctctg
aatgcccgctacaaggcggaggattaccagaacaagggcggttcgtctgccatggtccct
gatttcaccgcctctcagagcacggctattgtgaatgggctggatcccaagcagcaggcg
gtgttccaggccatcaagagcaacatgtccgaggagggaataaatcgaaaggagctgaag
gccaagttttcgcacatcagtgattccgaattgaccaacattttggactttatgatttcg
gagggccatatctactcgagcatagatgctgatcattttatttgcaccatgtaa

DBGET integrated database retrieval system