KEGG   Drosophila persimilis: Dper_GL19582Help
Entry
Dper_GL19582      CDS       T01063                                 

Definition
GL19582 gene product from transcript GL19582-RA
Orthology
K10739  
replication factor A2
Organism
dpe  Drosophila persimilis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dper_GL19582
   03420 Nucleotide excision repair
    Dper_GL19582
   03430 Mismatch repair
    Dper_GL19582
   03440 Homologous recombination
    Dper_GL19582
   03460 Fanconi anemia pathway
    Dper_GL19582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 237 aa AA seqDB search
MNDSFGDFNATQTAPAGAASNQKGEGIVPLFIKQIVDAPEGNIELFGMQFGMACLVAIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLNNYVKVYGTTRSQAGQKSLMV
FKLLPVLDPNEVCTHLLEALNARYKAEDYQNKGGSSAMVPDFTASQSTAIVNGLDPKQQA
VFQAIKSNMSEEGINRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcgtttggtgatttcaatgccacacagacggcaccggcgggcgccgccagc
aaccaaaaaggagagggaattgtgcctttgtttataaagcagattgtggatgcgcccgaa
gggaatattgagctgttcggcatgcaatttggcatggcgtgtctggtggcaatcgttcgg
aatgtggagacctcttccaccaagataacctatacgctggaggaccacagtggtcggatc
gatgcccactactggctggaggagggcgacgccctcaaggcaccggaagtgatgctaaac
aactacgtcaaggtctatggcaccacacgctcgcaggcgggccagaaatcgctgatggta
ttcaagctgctgcccgtcctggatcccaatgaggtgtgcacccacctacttgaggctctg
aatgcccgctacaaggcggaggattaccagaacaagggcggttcgtctgccatggtccct
gatttcaccgcctctcagagcacggctattgtgaatgggctggatcccaagcagcaggcg
gtgttccaggccatcaagagcaacatgtccgaggagggaataaatcgaaaggagctgaag
gccaagttttcgcacatcagtgattccgaattgaccaacattttggactttatgatttcg
gagggccatatctactcgagcatagatgctgatcattttatttgcaccatgtaa

DBGET integrated database retrieval system