KEGG   Drosophila persimilis: Dper_GL19611Help
Entry
Dper_GL19611      CDS       T01063                                 

Definition
GL19611 gene product from transcript GL19611-RA
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     Dper_GL19611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 774 aa AA seqDB search
MGQKLSYCKKCKDWWKKSDQEETKPRVRNVNANYLAGAPGRDTTDAANSAVLGVLRVDLC
QEDNHNEHHTSHFYAAAAKEALIVRRGEPFRLRIHFNRDYSPSKDAINFVFSVADDKNPR
PGHGTLTALVPHDGIDDLGDTLDWGAGIETHEGTLLTVLIKPPSTCPVTEWRLDIDTKLL
GDGSRSYPVPLPIYVLFNPWCPEDQVYLEDREQRKEYVMHDTTLIWRGSYNRLRPSVWKI
GQFERHVLECSLKVLGTVGRIPPAYRGDPVRVARALSALVNSVDDDGVLLGNWSEDFSGG
VAPTKWTGSPEILQQFHKTQKSVKFAQCWNFSGVLATIARSLGIPARIVTCYSSAHDTQA
SLTVDVFIDANNKKLDAETTDSIWNYHVWNELWMQRPDLGVGQHGAYDGWQVVDATPQEA
SDNMYRVGPASVLAVKHGEILRPFDGGFVFAEVNADKLYWRYNGPSQPLKLLRKDTLAIG
HLISTKAVLKWDREDITDSYKHAERSEEERSTMLKALKQSRHAFSRYYLNDNFNEVEFDM
ELKDDIKIGENFSVVLKVTNKSAEKSHLATGQVNCDAVLYTGVGAMEVKSIGFELELEPK
ASEYVRMEVIFEEYFEKLSSQAAFQISASARVKDTDYEYYAQDDFRVRKPDIKFQMGEGS
IVSRKEIDVIVRLVNPLPIPLHKGLFTVEGPGIEQPLKFKITEIPVGGTAAATFKYVPPY
AGRGTLLAKFTSKELDDVDGYKHYEIEPRPEDLLQPNGSHRSSNIIRRRTDVIA
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgggacagaaactgtcgtactgcaaaaagtgtaaggattggtggaagaagagtgatcag
gaggagaccaagcctcgtgtacgcaatgtcaatgccaactacttggcaggagctcccggt
cgagatacaacggatgcggctaattcggcggttctcggtgtgcttcgagtggatctctgc
caggaggataaccacaacgagcaccacacaagccacttctatgcggcggcggccaaggaa
gctctcatcgtgcgccgcggagaacccttccgcctgcgcattcacttcaaccgcgactac
agccccagcaaggatgccatcaactttgtcttcagcgtggccgatgacaagaatcccagg
ccaggacatggcacactgactgctctggtgccccacgatggcatcgacgatctgggcgac
accctggactggggagctggaattgagacgcacgagggtacgctcctgacggtgctgatc
aaaccgccctcgacttgtccggtgacagagtggcgtctggatatcgacaccaagctgctt
ggtgatggctcccgcagctatcccgttccgctgcccatctacgtgctgttcaatccgtgg
tgcccggaggatcaagtgtatctggaggatcgcgagcagcgcaaagagtacgtgatgcac
gacacgaccctcatctggagaggctcctacaaccggctgcgtccctcggtgtggaagatt
ggccagttcgagcggcatgttctcgaatgcagcctgaaggttctcggcaccgtgggcagg
atcccacccgcctacaggggcgatcctgtgcgggtggcccgtgccctgtccgcgctggta
aactctgtggatgatgatggtgtgctgctgggcaattggtcggaagatttctcgggcggc
gtggcgcccactaagtggacgggctccccggagatcttgcagcagttccacaagacccag
aagtccgtgaagttcgcccagtgctggaacttcagtggcgtcctggccaccattgcccgc
agtctgggcataccagcccgcatcgtgacatgttactcttctgctcatgatacccaggcc
tcgctcaccgtggacgtcttcatcgatgccaacaacaagaagctggacgcggagaccacc
gactccatctggaactaccatgtgtggaacgagctgtggatgcagcgtcccgatctgggc
gtgggccagcatggcgcctacgatggctggcaggttgtggatgccacgccccaggaggca
tcggacaacatgtaccgtgtgggcccagcctccgtgctggcggtgaagcatggcgagatc
ctcagacccttcgacggaggcttcgtctttgcggaggtcaatgcggacaagctctactgg
cggtacaacggtcccagtcagccgctgaagctgctgcgaaaggacaccctggccattgga
catctgatcagcaccaaggcggtcctcaagtgggatcgggaggacatcacggatagctac
aagcatgcggagcggtccgaggaggagcgtagcaccatgctgaaagccctgaagcaatca
cggcatgccttcagtcggtactaccttaacgacaacttcaacgaggtagagttcgatatg
gagctaaaggacgacatcaagatcggtgaaaactttagcgttgtcctaaaggtgaccaat
aagagtgcggaaaagagtcatctggccaccggtcaagtcaactgcgatgcggtgctttac
acgggcgtgggagccatggaggttaagtccatcggcttcgaactggagctggagccaaag
gccagcgaatacgtccgcatggaggtcatcttcgaggagtactttgagaaactctcttcc
caggcggcctttcagatctccgcctctgcgcgagtgaaggatacagactacgagtattat
gcccaggatgatttccgagtacgcaagccggacatcaagttccagatgggtgagggcagc
attgtgtcccgtaaagagattgatgtcattgtgcgcctggtcaatccactgccaataccc
ttgcacaaggggctcttcaccgtcgagggtcctggcatagagcagccactgaagtttaag
attaccgagatacctgttgggggaacagctgcagccacatttaagtatgtccccccgtat
gccggtcgtggcacacttcttgccaagtttacctccaaggaactggacgatgtggatggc
tataagcactacgagatcgagccccgtcccgaggatctgctccagcccaacggcagccat
agaagtagcaacatcatccgacgacgcacagatgttatagcataa

DBGET integrated database retrieval system