KEGG   Drosophila persimilis: Dper_GL20058Help
Entry
Dper_GL20058      CDS       T01063                                 

Gene name
Dper_Amy2
Definition
(RefSeq) GL20058 gene product from transcript GL20058-RA
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
dpe  Drosophila persimilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dper_GL20058 (Dper_Amy2)
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Dper_GL20058 (Dper_Amy2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 494 aa AA seqDB search
MFLTKTLGCIAFLAIASAQFNTNYVGGRSGMVHLFEWKWDDIAAECENFLGPQGYAGLQV
SPVNENAVKSGRPWWERYQPISYKLTTRSGNEEQFASMVRRCNNAGVRTYVDVIFNHMAA
DGGTYGTAGSTASPSSKSYPAVPYSSLDFNPTCAITNYNDADQVRNCELVGLRDLNQGNS
YVQEKVSDFLNHLIDLGVAGFRVDAAKHMWPADLGVIYGRLKNLNTDHGFASGSRPYIVQ
EVIDMGGEAISKTEYTGLGAITEFRHSDSIGKIFRGKDKLTYMSNWGTGWGFAASDRSLV
FVDNHDNQRGHGAGGADVLTYKVPKHTRWASAFMLAHPFGTPRVMSSFSFTDTDQGPPTT
DGQNIASPTFNSDKSCGGGWVCEHRWRQIYNMVAFRNAAGDADLQNWWSNGSNQISFSRG
NRAFVAFNNDNYDLNSSLQTGLPAGTYCDVISGEKSGSSCTGKTVTVGSDGRASISISSS
ADDGVLAIHVNAML
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgacaaagaccctcgggtgcatcgccttcctggcgatcgccagcgcccagttc
aacaccaactacgttggtggccgcagcggcatggtccacctcttcgagtggaagtgggac
gacatcgccgccgagtgcgagaacttcctgggcccccagggctacgccggtcttcaggtg
tcgcccgtcaacgagaacgccgtgaagagtgggcgtccgtggtgggagcgctaccagccc
atctcctacaagctgaccacccgttccggcaacgaggagcagttcgccagcatggtcagg
cgctgcaacaacgccggagtgcgcacctacgtggacgtcatcttcaaccacatggcagcc
gatggcggcacctacggcacagccggcagcaccgccagccccagctccaagagctacccc
gcagtgccctactcctccctggacttcaaccccacctgcgccatcaccaactacaacgac
gccgaccaggtgcgcaactgcgagctggtcggcctgcgtgacctcaaccagggcaactcg
tacgtccaggagaaggtttccgatttcctgaaccacttgatcgatctgggtgtggccgga
ttccgcgtggacgctgccaagcacatgtggcccgcagatctgggcgtcatctatggccgc
ctcaagaacctgaacaccgatcacggcttcgcgtccggatccaggccctacatcgtccag
gaggtcatcgacatgggtggcgaggccatcagcaaaaccgagtacactggcctgggcgcc
atcaccgagttccgccactccgactccatcggcaagatcttccgcggcaaggacaagctg
acctacatgtccaactggggcaccggctggggcttcgctgcctccgatcgctcgctcgtc
ttcgtcgacaaccacgacaaccagcgcggacacggtgcaggtggtgctgatgtgctcacc
tacaaggtgcccaagcatacaagatgggcctccgccttcatgctggcccatcccttcggc
actccccgtgtgatgtcctccttctccttcaccgacaccgaccagggcccacccaccacc
gacggacagaacattgcctctcccaccttcaacagcgacaagtcctgcggcggcggatgg
gtgtgcgagcaccgctggcgccagatctacaacatggtggccttcaggaacgccgccggc
gatgccgatctccagaactggtggtccaacggaagcaaccagatctccttcagccgtgga
aacagggccttcgtggccttcaacaacgacaactacgacctcaacagctccctgcagacc
ggcctgcccgccggcacctactgcgacgtcatctccggcgagaagagcggctcctcctgc
accggcaagaccgtcaccgttggctccgatggacgcgccagcatctccattagcagctcc
gctgacgatggtgtcctggccattcacgtcaacgccatgttgtaa

DBGET integrated database retrieval system