KEGG   Drosophila persimilis: Dper_GL20203Help
Entry
Dper_GL20203      CDS       T01063                                 

Definition
GL20203 gene product from transcript GL20203-RA
Orthology
K11204  
glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2]
Organism
dpe  Drosophila persimilis
Pathway
Glutathione metabolism
Metabolic pathways
Module
Glutathione biosynthesis, glutamate => glutathione
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dpe00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 246 aa AA seqDB search
MGLLSEGSPLSWEETKVLADHVREHGVNQFINLYHRLKDRQGDILKWGDEVEYIIVKFDE
KHKVARVALIAQDLLAQLNEKEMADPKGVKSLWRPEYGAYMIEGTPGKPFGGLMAHFNLV
EANMRYRREEVTELLAKDECVMSITNFPRLGSPNFTYPLAQPRPEDPLSSARSLYFPDEA
IFPGHPRFKTLTRNIRMRRGEKVSIKLKVFKDAQDKAARGGGHRRASRMWCCWTPWALAW
AAAACS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgggtctactaagcgagggcagtccactctcctgggaggagaccaaggtgctggccgat
catgtgcgcgagcatggcgtgaatcagttcataaatctctaccacagactgaaggaccgc
cagggggacatcctcaagtggggcgacgaggtggagtacatcattgtgaagttcgatgag
aagcataaggtggcccgcgtggcgttgatcgcccaggacctgctggctcagctaaacgaa
aaggagatggccgatcccaagggcgtgaagtcgctgtggcgtcccgaatacggtgcctac
atgatcgagggtacgcccggcaagcccttcggcggactgatggcccacttcaatctggtg
gaggccaatatgcgctatcgtcgcgaggaggtcaccgagctgctggccaaggacgagtgc
gtcatgtcgatcacaaactttccgcgcctcggatcccccaactttacataccccttggcc
cagccccgtccagaggatcccctcagctcggcccggtccctctactttcccgacgaggca
atattcccgggacatccgcgcttcaagacgctcacccgcaacattcgcatgcggcgcggc
gagaaggtctccatcaagctgaaggtgttcaaagacgcccaagacaaagctgcccgtgga
ggggggcaccgcagggcgagccggatgtggtgctgctggacgccatgggctttggcatgg
gctgctgctgcctgcagctaa

DBGET integrated database retrieval system