KEGG   Drosophila persimilis: Dper_GL20225Help
Entry
Dper_GL20225      CDS       T01063                                 

Definition
GL20225 gene product from transcript GL20225-RA
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dper_GL20225
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dper_GL20225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 351 aa AA seqDB search
MEDPNATETLQALASNFNAEAENLSWCQIESDPGVFTQLIRDFGCVGAQMEEIWSLDPDT
FKSLEPIHGLIFLVKWLADEQPTGRVVSDLGNIYFAQQVVRNSCATQAIISLLLNLSHPD
IELGETLTRFKHVTRELDPLSRGYCLSNEGKIRTAHNSFARPRISLQPRSTFVVDEPQQD
ESDADVYHFVGYMPIGEKLYELDGLRMGPTELAEIGPGQNWLDIVRPIIEERMQRYSADD
LNFNLMALVSDRQSFYESQIEQFQRRSLQMPKSQRESEMNHLLDRLRIEKEKNRQYRIEN
TRRRHNYLPFIVELLKQMGKNGQLLPILKQAQVNRTEYDQNSCNNGNAEKN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaagatcccaatgcaacggaaaccctccaggcactggcatcgaacttcaatgcagaa
gctgaaaatttgagctggtgccagatcgagagcgatcccggtgtcttcacacagctgata
cgtgactttggctgcgtgggagcgcagatggaggagatctggagcctggacccagacaca
ttcaagagcttggagccgatacacggcctcatctttctcgtcaagtggttggcggacgaa
cagcccactggccgtgtggtcagcgaccttggcaacatctacttcgcccagcaggtggtc
aggaattcctgcgccacccaggccatcatcagtctgctgctcaaccttagtcacccggac
atcgaactcggagagacactaacgcgctttaagcatgtcacccgcgagttggatccgctc
agtcgcggctactgcctgagtaacgaagggaagatccgcacagcccataactcgttcgcc
cgtccccgtataagtctccagccacgttccactttcgttgtggacgaaccccagcaagac
gagagcgatgcagacgtctaccactttgtcggctacatgcccataggcgagaagctctac
gagctggatggcttgcggatgggacccacggagttggccgagatcggaccgggccagaac
tggctggacatcgtccggccgataatcgaggagcgcatgcagcgctacagcgccgatgat
ctcaacttcaatctgatggcactggtctcggaccggcagagcttctacgagagccaaatc
gagcagttccaacggcgctcgctacagatgccgaaatcccagcgagagtcggagatgaac
catctgctcgacagactgcgaatcgagaaggagaagaaccgtcaataccgcattgagaac
acacgccgtcgtcacaactacttgcccttcatcgtggagctgctcaagcagatggggaag
aacggccaactactgccaatcttgaagcaggcccaggtaaatagaaccgagtacgaccag
aatagctgtaataacgggaatgccgagaaaaactaa

DBGET integrated database retrieval system