KEGG   Drosophila persimilis: Dper_GL20263Help
Entry
Dper_GL20263      CDS       T01063                                 

Definition
GL20263 gene product from transcript GL20263-RA
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
dpe  Drosophila persimilis
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dper_GL20263
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dper_GL20263
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dper_GL20263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1133 aa AA seqDB search
MDTQDTQEVEIITSDLHQQQQQQQQQQQQLQNQNQQQNSPPQLPKFKNLIHPQLHAVGGV
TQLPNENGNVPPQQLLADSSSSSFTTMDTMTLDDENKEDQFRSETTFSYTVDNVGQLKSQ
RLSPPVYVRMLPWKIMVIPNDRALGFFLQCNGENDSPTWSCNAIAELRLKCHKAESQPFT
RARIKHLFYSKENDYGYSNFITWQELQDSEKSYIHNNSITLEVHVIADAPHGVLWDSKKH
TGYVGLKNQGATCYMNSLLQTLYFTNSLRLAVYRIPTEADDSTKSVGLSLQRVFHELQFG
DRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTCLEGTIPGLFEGKMSS
YIKCKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVASETLEGDNKYDAGVHGLQEAS
KGVIFTSFPPVLHLHLMRFQYDPITDSSIKYNDRFEFYEQINLDQYLAEGEKTSADYVLH
AVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIELNYGGMDDEISFHAKC
SNAYMLVYIRQSELDRVLGDIPESEISSDLVERLDLEKRIEMARRKERSEANLYVSVHVI
LEEYFESQQKRRLFDLEKTHQRPFKLKQTQTVDELVEMFVKGFGVSRSRMRIWNMCTAQT
QKFLYFDFEAEASRSIEQIPTSQKPWVIFLELASPNTSEPLAPFNPKSDVLLFLKYYDAK
NKRLNYIGCTQQPQSRRLIDLCPEVNRKLGFDLDTELTVFDEYGDKKIANLNDPIESVLY
LPQDNLQGQILIFEREIIDMKLDLPTVEDYFLDLVYRIEIIFSDKCNPNEPDFVLELSNR
YNYDQLTNAVAERLNTDPQKLQFFMCINSYKETAGNAVPYTFKGTVKDLVSYTKQSTPKR
IYYQRLSLSIHELDNKKQFKCIWVSNDLKEEKELVLYPNKNDNVKGLLEEAAKKITFLEN
SRKKLRLMKVSNHKIVAHCKDDTPLDTLLKANDSSITTTQSAQKIYRIEEVPADEMQLVE
NEYLLPVAHFSKELYNSFGVPFFTKARHGESYGALKQRIQKRLNVPDKEWENYKFTVINT
GLTTEVNDNDVINLENFRTSNSGQLPFLGLDHINKSRKRSSLNFSEKAIKIYN
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atggacacccaggatacccaagaggtcgagataatcactagcgatcttcaccagcagcaa
caacaacagcaacaacagcagcagcagctccagaatcaaaaccaacagcagaattcgccc
ccacagctgcccaaattcaaaaatctgatacacccacaattgcacgcggtcggtggagtc
acccagctgcccaacgagaacggcaacgtgccgccacaacagctgctggccgacagcagc
tcctcatcgtttaccacaatggacacaatgacgttggacgacgagaacaaggaggatcag
ttccgttcggagaccacattctcctatacggtggataatgtgggacaattgaaatcacag
cgtctgtcaccgccagtgtacgtacggatgctgccatggaagattatggtcataccgaac
gaccgcgcattgggcttctttctgcagtgcaacggggagaatgattcgcccacctggtcg
tgcaatgccattgccgaattgcgtctcaagtgccacaaggccgagtctcagcctttcacg
cgggcccgcatcaagcatttgttctactcgaaggagaacgactatgggtattcgaacttt
atcacttggcaggagctgcaggattcggagaagagctatatacacaacaacagcatcacc
ttggaggtgcatgtcatagccgatgccccgcatggcgttctctgggattcgaagaagcac
accggctatgtgggcctcaagaatcagggggccacctgctacatgaactccctgctgcag
acgctctactttaccaattcgctgcgcctggccgtctatcgcatacccacagaggccgac
gatagcaccaaatcggtgggcctctccctgcagcgtgtattccacgagctgcagttcggc
gatcgtccggtgggcaccaagaagctaaccaaatcctttggctgggagacactcgactct
ttcatgcagcacgatgtccaggagttcctacgcgttctgctcgacaagctcgagtcgaaa
atgaagggcacctgcctcgaggggaccataccggggctctttgaggggaaaatgtcatca
tatatcaaatgcaagaatgtggactataacagcacacgctatgagaccttctacgatatc
cagctaaatatcaaagacaaaaagaacatttacgaatcatttcaggactatgtcgcctcc
gaaaccctcgagggtgacaacaaatacgatgctggcgtccatggcttacaggaggccagc
aagggcgtcatcttcacgtcattcccgcccgttctgcacttgcatttgatgcgtttccaa
tacgatcccattacggacagctcgatcaagtacaacgatcgtttcgagttctacgaacaa
atcaatctcgatcaatatctggccgagggcgagaagacatcagcggactatgtccttcat
gccgtgctggtgcattcgggcgacaatcatggcggacactatgtggtctttatcaatcca
aaggccgatgggcgctggttcaagtttgatgacgatgtggtctccagttgccgcaaacag
gaggccattgagctgaattatggcggcatggatgatgagatctcgttccatgccaaatgc
agcaatgcttatatgctggtgtacatcaggcaatcggaactggatcgtgtccttggcgat
atacctgagagtgagatatccagtgatctggtggagcgtctcgatctggagaagcgcatc
gagatggcgcgtcgcaaggagcgcagcgaggccaatctgtatgtgtcggtgcatgtcata
ctcgaggagtactttgagagtcaacagaagcgtcgtctcttcgacttggagaagacccat
cagcgtccgtttaagctcaagcagacccagaccgtcgacgaactggtcgaaatgttcgtc
aagggctttggcgtctcgcgcagtcgcatgcgcatttggaacatgtgcaccgcccagacg
caaaagtttctctatttcgactttgaggctgaggcatcgcgctccattgaacagataccc
acatcacagaagccatgggtgatcttcctcgagcttgcctccccgaacaccagcgaaccg
ctggcgcccttcaatcccaagtcagacgtgctgctcttcctcaagtattacgatgccaag
aacaagcgtctcaattatattggatgtacacagcagccgcagagccgacgcctcatcgat
ctgtgtccggaggttaaccgcaagctgggcttcgacctggacaccgagctgaccgtcttt
gatgagtatggcgacaagaagatcgccaatctgaatgatcccatcgagagtgtgctctat
ctgccgcaagacaatctacaggggcagatactcatctttgagcgtgagattattgacatg
aaactggatctgccaacggtggaggactactttctggatctggtctatcgcattgagatt
atattcagcgacaagtgtaatcccaatgaaccggactttgtcttggaattgtcgaatcgt
tataattacgatcagctaaccaatgcggtggccgagcgcctcaatacggatccgcagaag
ttgcagttctttatgtgcatcaacagctacaaggagacggcgggcaatgctgtgccctat
acattcaagggaacggtcaaggatctggtctcgtacaccaagcagagcacaccgaagcgc
atctattatcagcgtctttcgttgagcatccatgagctggacaacaagaagcaattcaag
tgcatttgggtgtccaacgatctgaaggaggagaaggagcttgtactctatccaaacaag
aatgacaacgttaaggggctgctggaggaggcggccaagaagataaccttcctggagaat
agccgcaagaagctgcggctgatgaaggttagcaatcataagattgtggcccactgcaag
gacgatacaccgctggatacgctgctcaaggcgaatgactcgtcgatcaccaccacacag
agtgcacagaaaatttatcgcatcgaggaggtgcccgcggatgagatgcagctggtcgag
aatgaatatctcttgccggttgctcatttcagcaaggagttgtacaactcgtttggcgta
cccttcttcaccaaggcgcgtcacggggagtcctatggggccctcaagcagcgcatccag
aagcgtctgaatgtcccggacaaggagtgggagaactacaagttcaccgtgatcaatacg
ggcctgaccaccgaggtgaacgacaacgatgtcatcaatttggagaatttccgcacctcg
aatagcggacagttgcccttccttggcctcgatcacattaacaagtcacgcaagcgcagt
tcgctgaatttctccgaaaaggcgatcaaaatttacaattaa

DBGET integrated database retrieval system