KEGG   Drosophila persimilis: Dper_GL20368Help
Entry
Dper_GL20368      CDS       T01063                                 

Definition
GL20368 gene product from transcript GL20368-RA
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
dpe  Drosophila persimilis
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Dper_GL20368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 918 aa AA seqDB search
MVVSTLSITLENNDSHVVDVPHGAATREGVGLPVPENTPQKFAVLCGSNNHPMNTNSNNN
NYNHFTNNTNKSQQQQQEKENVKLNNNSSQYFDMNGNGMDMETEMEMEMGLGVDVIQGSP
SPSIASTSMATPQRSASALRRGIQIQRSSTRLRQQQEQLRRRREEEERIAQQNEFLRNSL
RGSRKLKALQDSATPGKAIAMAQQQQPAPTGLAAMPMPAGVENEAYLPDEDQAQPQLQPQ
PEQIDGYGELIAALTRLQSQLSKSGLSTLAGRVSAAHSVLASASVAHVLAARTAVLQRRR
PRVSGPLHHNALGLQKDIVELLTQSNTAAAIELGNLLTSHEMEGLLLAHDRIANHTDGTP
SPTPTPTPAGGLGSMGSMSGASSPVSAAKRAAMAGGVVVPPPVVPVPSTLAQRGAMPLPR
GESPPPPPLPMPMPMAMPMSACFGTLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGR
IVRGGAAEKSGLLHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVPAGTGGPGS
GLGAHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGE
EDQTLAGLIPSQSFQHQRETMKLAIAEEAGLARSRGKDGASSKGATLLCARKGRKKKKKA
SSEAGYPLYATTAPDETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMA
DSERFSAAVPLFYLLEERLKEAKTKTKAKDTSRARREGEVPGVDYHFITRQAFEADILAR
RFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLD
KLRQKKLRNGEPFKEEELKDIIATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLE
REPQWVPAQWVHNNRDES
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggtggtctcaacgctgagcattacgttggagaacaacgacagccacgtggtggatgtg
ccacacggggctgccacgcgcgaaggtgttggattgcctgtaccagagaacacgccccag
aagtttgctgttctgtgcggcagcaacaatcatcctatgaacactaattccaacaacaat
aattacaatcatttcaccaacaacacgaacaaatctcaacaacaacagcaagaaaaggaa
aatgttaagctcaacaacaacagtagccaatatttcgatatgaacggcaatggtatggat
atggaaacggaaatggagatggagatgggactgggagtggatgtcattcaaggatcgcct
tcaccatcgatcgcttccacatcgatggccacgcctcagcgtagcgcctccgccctgcgt
cgcggcattcaaatccaacgatcctcgacacgtttgcggcaacaacaggagcaactgcgc
cgccgacgcgaggaggaggagcgcatcgcccagcagaatgagttcctgcggaacagtctg
cgcggctctcgcaagctgaaggcgctccaggactcggccacgcccggcaaggccatcgcc
atggcccagcagcagcagccggcgccgacgggactggcagccatgcccatgcccgccggt
gtggagaacgaggcgtatctgccggatgaagatcaggcgcagccacagctgcagccgcag
ccagagcagatcgatggctacggcgagctgatcgcggccctcacccgcctccagagccag
ctgagcaagagcggcctcagcacgctggccggacgcgtctcggcagcccacagcgttctg
gccagcgccagtgtcgcccacgtgctggccgcccgtaccgccgtcctgcagcgccgacgc
ccccgcgtcagcggccccctgcaccacaacgccctcggcctgcagaaggacatcgtggag
ctgctcacccagtcgaacaccgcggcggccatcgagctgggcaacctgctcaccagccac
gagatggagggcctcctgctagcccacgaccgcatcgccaaccacacggacggcacgccc
tcgcccacgccgacgcccacacccgccggtggattgggttcgatgggatcgatgagcgga
gccagcagtccggtgtcagcggcgaagagagcggcgatggccggtggcgtggtggtgcct
ccaccggtggttccggtcccgtcaacgctggcgcagcgcggagcaatgccgctgccgcgg
ggcgagtcgcccccaccgccgccgctgccaatgccaatgcccatggccatgccgatgagt
gcctgctttggaacgctcaacgaccagaacgacaacatccgaataatccagatcgagaag
tcgacggagccgctgggcgccaccgtgcgcaatgagggcgaggcggtggtcattgggcgg
atcgtgcgcggcggagccgccgagaagtccggcctgctccacgagggcgacgagatcctg
gaggtgaacggccaggagctgcgcggcaagactgtgaacgaggtgtgcgccctgctcggt
gcgatgcagggcacgctgacgttcctcatcgtgccggcgggcacgggcggacccggctcg
gggctgggggcacaccgggacacggccgtgctgcatgtacgggcgcacttcgactacgac
ccggaggacgatttgtacattccgtgccgggagctgggcatcagcttccagaagggcgat
gtgctgcacgtgatcagccgcgaggaccccaactggtggcaggcgtaccgcgagggcgag
gaggaccagacgctggccggcctcattcctagtcagtcgtttcagcaccagcgcgagacc
atgaagctggccatcgccgaggaggcgggcctggcccgctcccgtggcaaggacggggcc
agcagcaagggtgccaccctgctctgtgctcgcaagggccgcaaaaagaagaagaaggcc
agctccgaggcaggctatcccttgtacgccacgacggcgccggacgagaccgatccggag
gagatactcacctacgaggaggtggccctgtactatccgcgggccacccacaagcggccc
atcgtcctgatcggaccgcccaacatcggacgccacgagctgcgccagcgcctgatggcg
gactctgagcgcttctccgccgcagtgccactgttttatctgctcgaggagcgcctcaag
gaggccaagaccaagaccaaggccaaggacacatcacgtgcccggagggagggcgaggtg
cccggtgtcgactatcacttcatcacgcgccaggccttcgaagcggacattctggcccgt
cgcttcgtggagcacggggagtacgagaaggcctactacggcacatcactggaggccata
cgaacggtggtggccagcggcaagatctgcgtcctcaatctgcatccgcagagcctgaag
ctgctgcgagcctccgacctcaagccctatgtggtactggtggcgccccccagcctcgac
aagctgcggcagaagaagctgcgcaatggggaaccattcaaggaggaagagctcaaagac
atcattgccacggccagggacatggaggcccgatgggggcatctcttcgacatgatcatc
atcaacaatgatacggagcgcgcctaccaccagctgctggccgagatcaattcgctggag
cgcgagccgcagtgggtgcccgcccagtgggtgcacaacaatcgggacgagtcatag

DBGET integrated database retrieval system